Protein Info for BACOVA_03528 in Bacteroides ovatus ATCC 8483

Annotation: pseudouridine synthase, RluA family

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 357 TIGR00005: pseudouridine synthase, RluA family" amino acids 38 to 347 (310 residues), 290.3 bits, see alignment E=8.3e-91 PF01479: S4" amino acids 41 to 87 (47 residues), 28.5 bits, see alignment 1e-10 PF00849: PseudoU_synth_2" amino acids 116 to 273 (158 residues), 115 bits, see alignment E=3.7e-37

Best Hits

KEGG orthology group: K06180, ribosomal large subunit pseudouridine synthase D [EC: 5.4.99.12] (inferred from 97% identity to bth:BT_3712)

Predicted SEED Role

"Ribosomal large subunit pseudouridine synthase D (EC 4.2.1.70)" in subsystem Ribosome biogenesis bacterial (EC 4.2.1.70)

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

Compare fitness of predicted isozymes for: 4.2.1.70, 5.4.99.12

Use Curated BLAST to search for 4.2.1.70 or 5.4.99.12

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (357 amino acids)

>BACOVA_03528 pseudouridine synthase, RluA family (Bacteroides ovatus ATCC 8483)
MIEEELPDELENDLDDIEPVGDESQLYEHFRVVVDKGQAMVRVDKYLFERIVNASRNRIQ
KAAEDGFVMANGKPVKSSYKVKPLDVITVMMDRPRYENEIIPENIPLTIVYEDPYLMVVN
KPAGLVVHPGHGNYHGTLVNALAWHMKDIPDYDANDPHVGLVHRIDKDTSGLLVIAKTPD
AKTNLGIQFFNKTTKRKYRALVWGVMEQDEGTIVGNIARNPRDRMQMAVMSDPTVGKHAV
THYRVLERLGYVTLVECILETGRTHQIRVHMKHIGHVLFNDERYGGHEILKGTHFSKYKQ
FVNNCFDTCPRQALHAMTLGFVHPVTGEEMYFTSELPDDMTRLIEKWRGYISNRELE