Protein Info for BACOVA_03455 in Bacteroides ovatus ATCC 8483

Annotation: hypothetical protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 427 transmembrane" amino acids 12 to 36 (25 residues), see Phobius details amino acids 46 to 63 (18 residues), see Phobius details amino acids 75 to 95 (21 residues), see Phobius details amino acids 106 to 127 (22 residues), see Phobius details amino acids 145 to 164 (20 residues), see Phobius details amino acids 173 to 196 (24 residues), see Phobius details amino acids 218 to 240 (23 residues), see Phobius details amino acids 273 to 295 (23 residues), see Phobius details amino acids 303 to 324 (22 residues), see Phobius details amino acids 330 to 355 (26 residues), see Phobius details amino acids 365 to 386 (22 residues), see Phobius details amino acids 395 to 415 (21 residues), see Phobius details PF07690: MFS_1" amino acids 18 to 291 (274 residues), 40.2 bits, see alignment E=2.1e-14 PF03092: BT1" amino acids 29 to 127 (99 residues), 33.2 bits, see alignment E=2.6e-12

Best Hits

KEGG orthology group: K08218, MFS transporter, PAT family, beta-lactamase induction signal transducer AmpG (inferred from 89% identity to bth:BT_3620)

Predicted SEED Role

"AmpG permease"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (427 amino acids)

>BACOVA_03455 hypothetical protein (Bacteroides ovatus ATCC 8483)
MTTPTIKRNPWSWIPTLYFAEGLPYVAVMTIAVIMYKRLGLSNTEIALYTSWLYLPWTIK
PLWSPFVDLVKTKRAWIIAMQGFIAAGFAGIAFFIPTAHYVQLTLAFFWLLAFSSATHDI
AADGFYMLGLNNKEQSFFVGIRNTFYRLANIFGQGILVMLAGWLETSQNNIPLAWSITFY
LLAGLFLALTIYHRLILPHPDSDIKRPGLTPGKLLGDFLLTFVTFFKKKNLGLMFFFLLT
YRLGESQLAKIASPFLLDATDKGGLALSTATVGMIYGTIGVIALLVGGIISGFLVSRDGF
RKWILPMALAINLPDLLYVWMAAATPDNPIFIAICVAIEQLGYGFGFTAYMLYLIYIAEG
EHKTAHYAIGTGFMALGMMLPGMPAGWIQEHLGYTNFFIWVCICTLPGIVASLMIRNRLE
DSFGKKQ