Protein Info for BACOVA_03422 in Bacteroides ovatus ATCC 8483

Annotation: glycosyl hydrolase, family 31

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 550 600 650 700 750 814 signal peptide" amino acids 1 to 22 (22 residues), see Phobius details PF13802: Gal_mutarotas_2" amino acids 40 to 198 (159 residues), 51.8 bits, see alignment E=2.7e-17 PF01055: Glyco_hydro_31_2nd" amino acids 239 to 584 (346 residues), 323.1 bits, see alignment E=4.8e-100 PF21365: Glyco_hydro_31_3rd" amino acids 595 to 713 (119 residues), 82 bits, see alignment E=7.3e-27 PF17137: DUF5110" amino acids 730 to 796 (67 residues), 80.5 bits, see alignment E=1.6e-26

Best Hits

KEGG orthology group: K01811, putative family 31 glucosidase (inferred from 67% identity to psn:Pedsa_2575)

Predicted SEED Role

"Alpha-xylosidase (EC 3.2.1.-)" in subsystem Xylose utilization (EC 3.2.1.-)

KEGG Metabolic Maps

Isozymes

Compare fitness of predicted isozymes for: 3.2.1.-

Use Curated BLAST to search for 3.2.1.-

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (814 amino acids)

>BACOVA_03422 glycosyl hydrolase, family 31 (Bacteroides ovatus ATCC 8483)
MKIHHLFWGICLCFSTNILFAQNYQKTSSGIKTTVNAVDIEVQFFAPAVARVIKSPEGVA
YEKQSLSVIAKPEKVSFKADIQDNKIVLNTSELSVSVDTGTGIVSYFSKDGKSLLAEKSG
MQFIDFDDAGTKTYQVYQPFILDKEEAIYGLGQLQNGKMIQRNMTKNLIQGNVEDVSPFF
QSTKGYGVFWDNYSPTLFTDNEVETSFRSEVGDCVDYYFMYGKDADGVIAQVRSLTGQAP
MFPLWTYGYWQSKERYKSQEEVVDVVRKYRELGIPLDGIIQDWQYWGHNYLWNAMDFQNP
TFNNPQKMMEDVHAMNAHMAISIWSSFGPMTKPYRELDKKGMLFNFTTWPQSGLESWPPN
MEYPSGVRVYDAYNPEARDIYWKYLNDGIFKLGMDAWWMDSTEPDHLDWKPEDMDTKTYL
GSFRRVRNAYPLMTVGGVYDHQRAVTSDKRVFILTRSGFLGQQRYGANVWSGDVASTWES
FRNQIPAGLNFSLCGMPHWNSDIGGFFAGHYNKSWNDDSASKNPLYQELYVRWLQFGTFN
PMMRSHGTDVYREIYKFGKKGEPVYDAIEKMIGLRYSLLPYIYSTSWEVSNRQSSFMRAL
MMDFVDDRKVWDINDEYMFGKSILVAPIAHAQYTPEAVVKVSEEEGWNRDGAKKTKTDAA
VDFMETKSTNIYLPAGTLWYDFWTNEKHEGGKEITKETTLDVIPLYVKAGSIIPVGPQVQ
YATEKPWDHLELKVYAGANGNFILYEDEFDNYNYEKGAYTEIPISWNNASRKLTIGARKG
AYEGMLKNRKFTVTLQDGTQKNIDYNGKAISVKF