Protein Info for BACOVA_03357 in Bacteroides ovatus ATCC 8483

Annotation: antioxidant, AhpC/TSA family

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 392 signal peptide" amino acids 1 to 18 (18 residues), see Phobius details PF14289: DUF4369" amino acids 19 to 108 (90 residues), 52.9 bits, see alignment E=1.3e-17 PF00578: AhpC-TSA" amino acids 259 to 375 (117 residues), 83.1 bits, see alignment E=5e-27 PF08534: Redoxin" amino acids 259 to 382 (124 residues), 60.8 bits, see alignment E=4.1e-20 PF13905: Thioredoxin_8" amino acids 285 to 372 (88 residues), 60.3 bits, see alignment E=5.7e-20

Best Hits

Predicted SEED Role

"thioredoxin family protein"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (392 amino acids)

>BACOVA_03357 antioxidant, AhpC/TSA family (Bacteroides ovatus ATCC 8483)
MILCTFCAIAIFSSAQGKFSIKGNAGEKWNNQLLYLCLMDDGEKAKEVVLDSAKVKKGKF
SFSGVRQTPNIALIKDRDGETYPLILEKGKIVINLTTRTVGGTPLNDTLDVAWKGMQSVI
NNNKQIVKSNISLVMSQKSGGSFREALKRDTTFAAIWRRNVEIDLAQRDSIRAFVEEHQN
SLVGVFLLSLEEVSMYYSLLEDMMSEASPVFSQHVLVKDKLEKMRQMARRFEAEREKKMT
PEEREEQKKRQAMDAKIKIGERFPNAKVKDNAGEIKQLSDYVGKGKYVLIDFWASWCGPC
RNEMPNVKAAYEKYASKGFEVISISIDKKQKPWRTAIEELGMNWTQVLNVDAADIYGIYA
IPKTFLVDPEGIVVAKDLRSKKLEKTLLKLLE