Protein Info for BACOVA_03276 in Bacteroides ovatus ATCC 8483

Annotation: hypothetical protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• PF02283: CobU
  • amino acids 4 to 44 (41 residues), 43.1 bits, E=1.7e-15

Predicted SEED Role

"Adenosylcobinamide-phosphate guanylyltransferase (EC 2.7.7.62)" in subsystem Cobalamin synthesis or Coenzyme B12 biosynthesis (EC 2.7.7.62)

MetaCyc Pathways

• superpathway of adenosylcobalamin salvage from cobinamide I (8/8 steps found)
• adenosylcobinamide-GDP salvage from cobinamide I (5/5 steps found)
• superpathway of adenosylcobalamin salvage from cobinamide II (7/9 steps found)
• adenosylcobinamide-GDP biosynthesis from cobyrinate a,c-diamide (4/6 steps found)
• adenosylcobinamide-GDP salvage from cobinamide II (4/6 steps found)
• adenosylcobinamide-GDP salvage from assorted adenosylcobamides (1/2 steps found)
• adenosylcobalamin biosynthesis II (aerobic) (11/33 steps found)
• adenosylcobalamin biosynthesis I (anaerobic) (10/36 steps found)

Isozymes

Compare fitness of predicted isozymes for: 2.7.7.62

Use Curated BLAST to search for 2.7.7.62

Protein Sequence (45 amino acids)

>BACOVA_03276 hypothetical protein (Bacteroides ovatus ATCC 8483)
MVGGGVSENKLQRKFTDLQGWTNQYIASHADDVYLMASGIPVKIK