Protein Info for BACOVA_03235 in Bacteroides ovatus ATCC 8483

Annotation: lysine--tRNA ligase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 550 575 TIGR00499: lysine--tRNA ligase" amino acids 7 to 503 (497 residues), 613.2 bits, see alignment E=1.7e-188 PF01336: tRNA_anti-codon" amino acids 55 to 138 (84 residues), 56.2 bits, see alignment E=5.4e-19 PF00152: tRNA-synt_2" amino acids 162 to 499 (338 residues), 318.5 bits, see alignment E=9.4e-99 PF14229: DUF4332" amino acids 508 to 574 (67 residues), 29.7 bits, see alignment E=1.3e-10

Best Hits

Swiss-Prot: 96% identical to SYK_BACTN: Lysine--tRNA ligase (lysS) from Bacteroides thetaiotaomicron (strain ATCC 29148 / DSM 2079 / NCTC 10582 / E50 / VPI-5482)

KEGG orthology group: K04567, lysyl-tRNA synthetase, class II [EC: 6.1.1.6] (inferred from 96% identity to bth:BT_2122)

Predicted SEED Role

"Lysyl-tRNA synthetase (class II) (EC 6.1.1.6)" (EC 6.1.1.6)

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

No predicted isozymes

Use Curated BLAST to search for 6.1.1.6

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (575 amino acids)

>BACOVA_03235 lysine--tRNA ligase (Bacteroides ovatus ATCC 8483)
MNILELSEQEIIRRNSLNELRAMGIDPYPAAEYVTNAFSTDIKAEFKDDEEPRQVSVAGR
IMSRRVMGKASFIELQDSKGRIQVYITRDDICPGEDKELYNAVFKRLLDLGDFIGIEGFV
FRTQMGEISIHAKKLTVLAKSIKPLPIVKYKDGVAYDSFEDPELRYRQRYVDLVVNDGIK
ETFLKRATVVKTLRNVLDEAGYTEVETPILQSIAGGASARPFITHHNSLDIDLYLRIATE
LYLKRLIVGGFEGVYEIGKNFRNEGMDKTHNPEFTCMELYVQYKDYNWMMNFTEKLLERI
CIAVNGCTESVVDGKTISFKAPYRRLPILDAIKEKTGYDLNGKSEEEIRQVCKELKMEEI
DETMGKGKLIDEIFGEFCEGTYIQPTFITDYPVEMSPLTKMHRSKPGLTERFELMVNGKE
LANAYSELNDPLDQEERFKEQMRLADKGDDEAMIIDQDFLRALQYGMPPTSGIGIGIDRL
VMLMTGQTTIQEVLFFPQMRPEKVVKKDAAAKYMELGIAEDWVPVIQKAGYNTVADMKDV
NPQKLHQDICGINKKYKLELTNPSVNDVTEWIQKI