Protein Info for BACOVA_02960 in Bacteroides ovatus ATCC 8483

Annotation: Hexokinase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 402 transmembrane" amino acids 312 to 332 (21 residues), see Phobius details PF00349: Hexokinase_1" amino acids 5 to 185 (181 residues), 110.8 bits, see alignment E=8.2e-36 PF03727: Hexokinase_2" amino acids 196 to 276 (81 residues), 75.5 bits, see alignment E=4.5e-25 amino acids 303 to 401 (99 residues), 27 bits, see alignment E=2.8e-10

Best Hits

KEGG orthology group: None (inferred from 87% identity to bth:BT_2430)

Predicted SEED Role

"Hexokinase (EC 2.7.1.1)" in subsystem Entner-Doudoroff Pathway or Glycolysis and Gluconeogenesis or Glycolysis and Gluconeogenesis, including Archaeal enzymes or Mannose Metabolism (EC 2.7.1.1)

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

No predicted isozymes

Use Curated BLAST to search for 2.7.1.1

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (402 amino acids)

>BACOVA_02960 Hexokinase (Bacteroides ovatus ATCC 8483)
MEKNIFQLNNEQLKEIARSFKAKVEEGLNTENAEIQCIPTFITPKASGINGKSLVLDLGG
TNYRVAIVDFSKMPPTIHPNNGWKKDMSIMKTPGYTREELFKEMADMITGIKREKEMPIG
YCFSYPTESVPGGDAKLLRWTKGVDIKEMIGEVVGKPLLDYLNERNKIKFTNIKVLNDTV
ASLFAGLTDSSYDAYIGLIVGTGTNMATFIPADKIKKLNPSHKVDGLIPVNLESGNFHPP
FLTAVDNTMDGISGNPGKQRFEKAVSGMYLGDILKATFPLEEFEEKFDAQKLTSIMNYPD
IYKEVYVEVAQWIYSRSAQLVAASLTGLIMLLKSYNKNIRKICLVAEGSLFWSKNRKDKN
YNMIVMEKLRELFSLFGLEDVEVDIKSMNNANLIGTGIAALS