Protein Info for BACOVA_02960 in Bacteroides ovatus ATCC 8483

Annotation: Hexokinase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• PF00349: Hexokinase_1
  • amino acids 5 to 185 (181 residues), 110.8 bits, E=8.2e-36
• PF03727: Hexokinase_2
  • amino acids 196 to 276 (81 residues), 75.5 bits, E=4.5e-25
  • amino acids 303 to 401 (99 residues), 27 bits, E=2.8e-10

Best Hits

KEGG orthology group: None (inferred from 87% identity to bth:BT_2430)

Predicted SEED Role

"Hexokinase (EC 2.7.1.1)" in subsystem Entner-Doudoroff Pathway or Glycolysis and Gluconeogenesis or Glycolysis and Gluconeogenesis, including Archaeal enzymes or Mannose Metabolism (EC 2.7.1.1)

MetaCyc Pathways

• glycolysis III (from glucose) (11/11 steps found)
• homolactic fermentation (11/12 steps found)
• glycogen degradation I (7/8 steps found)
• Bifidobacterium shunt (12/15 steps found)
• heterolactic fermentation (14/18 steps found)
• glycogen degradation II (5/6 steps found)
• sucrose degradation III (sucrose invertase) (3/4 steps found)
• GDP-α-D-glucose biosynthesis (2/3 steps found)
• trehalose degradation IV (2/3 steps found)
• trehalose degradation V (2/3 steps found)
• trehalose degradation I (low osmolarity) (1/2 steps found)
• trehalose degradation II (cytosolic) (1/2 steps found)
• 1,3-propanediol biosynthesis (engineered) (6/9 steps found)
• glucose and glucose-1-phosphate degradation (3/5 steps found)
• sucrose biosynthesis II (5/8 steps found)
• UDP-N-acetyl-D-galactosamine biosynthesis II (4/7 steps found)
• UDP-N-acetyl-D-glucosamine biosynthesis II (3/6 steps found)
• chitin biosynthesis (4/9 steps found)

KEGG Metabolic Maps

• Aminosugars metabolism
• Biosynthesis of alkaloids derived from histidine and purine
• Biosynthesis of alkaloids derived from ornithine, lysine and nicotinic acid
• Biosynthesis of alkaloids derived from shikimate pathway
• Biosynthesis of alkaloids derived from terpenoid and polyketide
• Biosynthesis of phenylpropanoids
• Biosynthesis of plant hormones
• Biosynthesis of terpenoids and steroids
• Fructose and mannose metabolism
• Galactose metabolism
• Glycolysis / Gluconeogenesis
• Nucleotide sugars metabolism
• Starch and sucrose metabolism
• Streptomycin biosynthesis

Isozymes

No predicted isozymes

Use Curated BLAST to search for 2.7.1.1

Protein Sequence (402 amino acids)

>BACOVA_02960 Hexokinase (Bacteroides ovatus ATCC 8483)
MEKNIFQLNNEQLKEIARSFKAKVEEGLNTENAEIQCIPTFITPKASGINGKSLVLDLGG
TNYRVAIVDFSKMPPTIHPNNGWKKDMSIMKTPGYTREELFKEMADMITGIKREKEMPIG
YCFSYPTESVPGGDAKLLRWTKGVDIKEMIGEVVGKPLLDYLNERNKIKFTNIKVLNDTV
ASLFAGLTDSSYDAYIGLIVGTGTNMATFIPADKIKKLNPSHKVDGLIPVNLESGNFHPP
FLTAVDNTMDGISGNPGKQRFEKAVSGMYLGDILKATFPLEEFEEKFDAQKLTSIMNYPD
IYKEVYVEVAQWIYSRSAQLVAASLTGLIMLLKSYNKNIRKICLVAEGSLFWSKNRKDKN
YNMIVMEKLRELFSLFGLEDVEVDIKSMNNANLIGTGIAALS