Protein Info for BACOVA_02893 in Bacteroides ovatus ATCC 8483

Annotation: succinate CoA transferase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 499 TIGR03458: succinate CoA transferase" amino acids 3 to 489 (487 residues), 769.1 bits, see alignment E=8.4e-236 PF02550: AcetylCoA_hydro" amino acids 5 to 211 (207 residues), 117 bits, see alignment E=1.2e-37 PF13336: AcetylCoA_hyd_C" amino acids 317 to 458 (142 residues), 156 bits, see alignment E=7.4e-50

Best Hits

Swiss-Prot: 52% identical to SCPC_ECOLI: Propionyl-CoA:succinate CoA transferase (scpC) from Escherichia coli (strain K12)

KEGG orthology group: None (inferred from 97% identity to bth:BT_3193)

MetaCyc: 52% identical to propionyl-CoA:succinate CoA transferase (Escherichia coli K-12 substr. MG1655)
RXN0-268 [EC: 2.8.3.27]

Predicted SEED Role

"Propionyl-CoA:succinyl-CoA transferase"

MetaCyc Pathways

Isozymes

No predicted isozymes

Use Curated BLAST to search for 2.8.3.27

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (499 amino acids)

>BACOVA_02893 succinate CoA transferase (Bacteroides ovatus ATCC 8483)
MSLNRISAAEAASLIKHGYNIGLSGFTPAGTAKAVTAELAKIAEAEHAKGNPFQVGIFTG
ASTGESCDGVLSRAKAIRYRAPYTTNSDFRKAVNNGEIAYNDIHLSQMAQEVRYGFMGKV
NVAIIEACEVTPDGKIYLTAAGGIAPTICRLADQIIVELNSAHSKSCMGLHDVYEPLDPP
YRREIPIYKPSDRIGLPYVQVDPKKIIGVVETNWPDEARSFAAADPLTDKIGQNVADFLA
ADMKRGIIPSTFLPLQSGVGNIANAVLGALGRDKTIPPFEMYTEVIQNSVIGLIREGRIK
FGSACSLTVTNDCLEGIYNDMDFFRDKLVLRPSEISNSPEIVRRLGIISINTAIEVDLYG
NVNSTHIGGTKMMNGIGGSGDFTRNAYISIFTCPSVAKEGKISAIVPMVSHHDHTEHDVN
IVITEQGVADLRGKSPKERAQAIIENCAHPDYKELLWDYLKLAGNRAQTPHAIQAALGMH
AELAKSGDMKNTNWAEYAK