Protein Info for BACOVA_02890 in Bacteroides ovatus ATCC 8483

Annotation: dihydrolipoyl dehydrogenase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 447 TIGR01350: dihydrolipoyl dehydrogenase" amino acids 2 to 446 (445 residues), 463.9 bits, see alignment E=2.8e-143 PF07992: Pyr_redox_2" amino acids 3 to 319 (317 residues), 250.6 bits, see alignment E=1.4e-77 PF03486: HI0933_like" amino acids 4 to 35 (32 residues), 26.5 bits, see alignment (E = 1.7e-09) PF00890: FAD_binding_2" amino acids 5 to 35 (31 residues), 23.5 bits, see alignment (E = 1.9e-08) PF12831: FAD_oxidored" amino acids 5 to 47 (43 residues), 32.6 bits, see alignment 3.4e-11 PF13738: Pyr_redox_3" amino acids 6 to 303 (298 residues), 48.5 bits, see alignment E=4.4e-16 PF13450: NAD_binding_8" amino acids 7 to 42 (36 residues), 24 bits, see alignment 2.3e-08 PF00070: Pyr_redox" amino acids 169 to 242 (74 residues), 77.7 bits, see alignment E=4.9e-25 PF02852: Pyr_redox_dim" amino acids 338 to 445 (108 residues), 91.8 bits, see alignment E=2e-29

Best Hits

Swiss-Prot: 37% identical to DLDH1_ARATH: Dihydrolipoyl dehydrogenase 1, mitochondrial (LPD1) from Arabidopsis thaliana

KEGG orthology group: K00382, dihydrolipoamide dehydrogenase [EC: 1.8.1.4] (inferred from 92% identity to bth:BT_3186)

MetaCyc: 37% identical to glycine cleavage system L protein 1 (Arabidopsis thaliana col)
GCVMULTI-RXN [EC: 1.4.1.27]

Predicted SEED Role

"Dihydrolipoamide dehydrogenase (EC 1.8.1.4)" in subsystem Glycine cleavage system or Leucine Degradation and HMG-CoA Metabolism or Photorespiration (oxidative C2 cycle) or TCA Cycle (EC 1.8.1.4)

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

Compare fitness of predicted isozymes for: 1.8.1.4

Use Curated BLAST to search for 1.4.1.27 or 1.8.1.4

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (447 amino acids)

>BACOVA_02890 dihydrolipoyl dehydrogenase (Bacteroides ovatus ATCC 8483)
MKYQVIIIGGGPAGYTAAEAAGKGGLSVLLIEKNSLGGVCLNEGCIPTKTLLYSAKTYDS
AKHASKYAVNIPEVSFDLPKIIARKSKVVRKLVLGVKAKLTANNVTIVSGEAQIIDKNTV
RCGEEIYEGENLILCTGSETFIPPIPGVDAVNYWTHRDALDSKELPASLAIVGGGVIGME
FASFFNSLGVQVAVVEMMDEILGGMDKELSALLRAEYAKRGIKFLLGTKVVDLSQTGEGA
VVSYENAEGNGSVIAEKLLMSVGRRPVTKGFGLENLNLEQTERGAIRVNEKMQTSVPDVY
VCGDLTGFSLLAHTAVREAEVAVHSILGKEDAMSYRAIPGVVYTNPEIAGVGETEESAST
KGINYQVIKLPMAYSGRFVAENEGVNGVCKVLLDEQQRVIGAHVLGNPASEIITLAGTAI
ELGLTAAQWKKIVFPHPTVGEIFREVL