Protein Info for BACOVA_02824 in Bacteroides ovatus ATCC 8483

Annotation: DNA mismatch repair protein MutS

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 550 600 650 700 750 800 850 898 TIGR01070: DNA mismatch repair protein MutS" amino acids 34 to 893 (860 residues), 927.9 bits, see alignment E=3.4e-283 PF01624: MutS_I" amino acids 35 to 146 (112 residues), 138.8 bits, see alignment E=2.2e-44 PF05188: MutS_II" amino acids 155 to 280 (126 residues), 72.1 bits, see alignment E=1.6e-23 PF05192: MutS_III" amino acids 298 to 586 (289 residues), 155.4 bits, see alignment E=6e-49 PF05190: MutS_IV" amino acids 455 to 545 (91 residues), 98.3 bits, see alignment E=6.5e-32 PF00488: MutS_V" amino acids 640 to 829 (190 residues), 277.9 bits, see alignment E=1.2e-86

Best Hits

Swiss-Prot: 96% identical to MUTS_BACTN: DNA mismatch repair protein MutS (mutS) from Bacteroides thetaiotaomicron (strain ATCC 29148 / DSM 2079 / NCTC 10582 / E50 / VPI-5482)

KEGG orthology group: K03555, DNA mismatch repair protein MutS (inferred from 96% identity to bth:BT_3121)

Predicted SEED Role

"DNA mismatch repair protein MutS" in subsystem DNA repair, bacterial MutL-MutS system

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (898 amino acids)

>BACOVA_02824 DNA mismatch repair protein MutS (Bacteroides ovatus ATCC 8483)
MILCRKTVIFARIIHYILNKKEKETPVNEEEIVLTPMMKQFLDLKAKHPDAVMLFRCGDF
YETYSTDAIVAAEILGITLTKRANGKGKTIEMAGFPHHALDTYLPKLVRAGKRVAICDQL
EDPKMTKKLVKRGITELVTPGVSINDNVLNYKENNFLAAVHFGKASCGVAFLDISTGEFL
TAEGPFDYIDKLLNNFAPKEILFERGKRLMFEGNFGNKFFTFELDDWVFTETTAREKLLK
HFETKNLKGFGVEHLKNGIIASGAILQYLTMTQHTQIGHITSLARIEEDKYVRLDKFTVR
SLELIGNMNDGGSSLLNVIDRTISPMGARLLKRWMVFPLKDEKPINERLNVVEYFFRQPD
FKELIEEQLHLIGDLERIISKVAVGRVSPREVVQLKVALQAIEPIKQACMEADNASLNRI
GEQLNLCISIRDRIAKEIKNDPPLLINKGGVIQDGVNADLDELRQISYSGKDYLLKIQQR
ESEETGIPSLKVAYNNVFGYYIEVRNVHKDKVPKEWIRKQTLVNAERYITQELKEYEEKI
LGAEDKILILETQLYTDLVQALMEFIPQIQINANQIARLDCLLSFANVARENRYIRPIIE
DNDVLDIRQGRHPVIEKQLPIGEKYIANDVMLDSDTQQIIIITGPNMAGKSALLRQTALI
TLLAQIGSFVPAESAHIGLVDKIFTRVGASDNISVGESTFMVEMNEAADILNNVSSRSLV
LFDELGRGTSTYDGISIAWAIVEYIHEHPKAKARTLFATHYHELNEMEKSFKRIKNYNVS
VKEVDNKVIFLRKLERGGSEHSFGIHVAKMAGMPKSIVKRANEILKQLESDNRQQGIAGK
PLAEVSENRGGMQLSFFQLDDPILCQIRDEILNLDVNNLTPIEALNKLNDIKKIVRGK