Protein Info for BACOVA_02734 in Bacteroides ovatus ATCC 8483

Annotation: Fibrobacter succinogene major paralogous domain protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 377 signal peptide" amino acids 1 to 21 (21 residues), see Phobius details TIGR02145: fibrobacter succinogenes major paralogous domain" amino acids 143 to 377 (235 residues), 95.4 bits, see alignment E=3.2e-31 PF09603: Fib_succ_major" amino acids 157 to 376 (220 residues), 107.8 bits, see alignment E=4.6e-35

Best Hits

Predicted SEED Role

"Glycerate kinase (EC 2.7.1.31)" in subsystem Allantoin Utilization or D-galactarate, D-glucarate and D-glycerate catabolism or Glycerolipid and Glycerophospholipid Metabolism in Bacteria or Glycine and Serine Utilization or Photorespiration (oxidative C2 cycle) or Serine-glyoxylate cycle (EC 2.7.1.31)

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

Compare fitness of predicted isozymes for: 2.7.1.31

Use Curated BLAST to search for 2.7.1.31

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (377 amino acids)

>BACOVA_02734 Fibrobacter succinogene major paralogous domain protein (Bacteroides ovatus ATCC 8483)
MKKILLTSFIVALGLLGASCKDDNSTAGGGGEILPDQQVSCEIFMPTNGETVIISDKLII
RGEGTTNYGKIISAELKVGGEVITDISSVPFYYEYTFPKEAEPGELKIELAVKGDHEGSA
LATITVTTELGDRPAPPQYGEDLTDTRDGNVYKTIQLAEQIWMAENLRYLPEQNFDISST
APKYYVMFDSDIKTDLGKAYLKAYGAYYNLPAALQGETALGEDETRNIKGVCPDGWHIPS
QKEWQTLSKYVLDSGMAAIMNDGQVDETAIAKALASTTMWMLPEYTEIEPQPTWVGVEME
KNNATLFNGLPIGFRACAGDEDWMHSCYSAGWWSSTAGVQMGPEFGITVRLWSDLHTFVT
NAEFNPGVGLPVRCIKD