Protein Info for BACOVA_02649 in Bacteroides ovatus ATCC 8483

Annotation: N-terminal ig-like domain of cellulase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 550 587 signal peptide" amino acids 1 to 26 (26 residues), see Phobius details transmembrane" amino acids 567 to 586 (20 residues), see Phobius details PF02927: CelD_N" amino acids 30 to 107 (78 residues), 66.9 bits, see alignment E=2.2e-22 PF00759: Glyco_hydro_9" amino acids 122 to 574 (453 residues), 284.9 bits, see alignment E=1.6e-88

Best Hits

Swiss-Prot: 100% identical to BGH9A_BACO1: Xyloglucan-specific endo-beta-1,4-glucanase BoGH9A (BACOVA_02649) from Bacteroides ovatus (strain ATCC 8483 / DSM 1896 / JCM 5824 / NCTC 11153)

KEGG orthology group: None (inferred from 47% identity to sli:Slin_5052)

Predicted SEED Role

"Endoglucanase D precursor (EC 3.2.1.4)" (EC 3.2.1.4)

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

Compare fitness of predicted isozymes for: 3.2.1.4

Use Curated BLAST to search for 3.2.1.4

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (587 amino acids)

>BACOVA_02649 N-terminal ig-like domain of cellulase (Bacteroides ovatus ATCC 8483)
MKIVRYIALFGILSGLAVACTPSTSVIPNDAIRLNQLGYYPNQEKIAVVDSGKVEEFVIW
DAVSGEQVFVGKSLYTAKSAWSDKTRTTLDFSAVTTPGKYILKVNGASVTFLIKDSVLSP
LADAALKSFYYQRTAMPIEEQYAGQWHRMAGHPDNHVLIHPSAASPDRPAGTIVSSSKGW
YDAGDYNKYIVNSGYSIGLMQSIYQLFLDYFSRQKINIPESNNHTPDLLDEMQFNLDWML
TMQDPEDGGVYHKLTTPFFEGFVKPVDCKQQRYVVQKSVTAALDFAAVMAQSSRLFASYE
EDYPGFSKRALLAAEKAYAWAEKHPEAYYNQNLLNQKYQPAIATGEYGDTHADDEFFWAA
SELYFSTGKEIYREEAIKKAPQIYTAPGWGNTFALGIFAWLQPGRELNEADRRFADSLKT
ELLKYADKVIEGAEQTPFHAPYGNDAKDFFWGCLAEKCMNQGVSLMYAYLQTGKDVYLTN
AYRNMDYILGRNATGFCYVTGLGTKSPKHPHHRLSASDDIEDPIPGFLVGGPNPGQQDGA
FYPTASPDESYVDTEDSYASNEVAINWNAALVALASSLDALAVYSVK