Protein Info for BACOVA_02539 in Bacteroides ovatus ATCC 8483

Annotation: hypothetical protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 349 transmembrane" amino acids 7 to 30 (24 residues), see Phobius details amino acids 42 to 62 (21 residues), see Phobius details amino acids 74 to 98 (25 residues), see Phobius details amino acids 104 to 125 (22 residues), see Phobius details amino acids 156 to 177 (22 residues), see Phobius details amino acids 184 to 207 (24 residues), see Phobius details amino acids 228 to 246 (19 residues), see Phobius details amino acids 257 to 280 (24 residues), see Phobius details amino acids 292 to 312 (21 residues), see Phobius details amino acids 320 to 342 (23 residues), see Phobius details PF10951: DUF2776" amino acids 1 to 347 (347 residues), 575.2 bits, see alignment E=2.9e-177

Best Hits

Swiss-Prot: 47% identical to YHIM_ECOLI: Inner membrane protein YhiM (yhiM) from Escherichia coli (strain K12)

KEGG orthology group: None (inferred from 90% identity to bth:BT_0805)

Predicted SEED Role

"FIG00896814: hypothetical protein"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (349 amino acids)

>BACOVA_02539 hypothetical protein (Bacteroides ovatus ATCC 8483)
MNYGISILFRAIPLAMAIFCFGYGAFIYGYGDDGSRVVAGPVVFSLGMICIALFCTAATI
IRQIIHTYNKSAKYVLPIIGYLAAIITIIGGICIFSNATSTSAFVAGHVITGVGFITTCV
ATAATSSTRFSLIPRNSKATSNEVPEGAFSLNQRRALVIVAIIVSLIAWIWAFVLLGNSH
SHPAYFVAGHVMVGLACICTSLIALVATIARQIRNDYSEKERNKWPKLVLLMGSISFVWG
LFVILADSGSANGTTGYIMLGLGLVCYSISSKVILLAKIWRQEFKLANRIPMIPVLTALT
CLFLAAFVFELATIHADYFIPARVLVGLGAICFTLFSIVSILESGTSSK