Protein Info for BACOVA_02527 in Bacteroides ovatus ATCC 8483

Annotation: succinate-CoA ligase, beta subunit

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• TIGR01016: succinate-CoA ligase, beta subunit
  • amino acids 1 to 374 (374 residues), 495.9 bits, E=3.9e-153
• PF08442: ATP-grasp_2
  • amino acids 2 to 195 (194 residues), 235.1 bits, E=9.3e-74
• PF13549: ATP-grasp_5
  • amino acids 4 to 128 (125 residues), 31.1 bits, E=2.4e-11
• PF00549: Ligase_CoA
  • amino acids 255 to 353 (99 residues), 102.1 bits, E=3.9e-33

Best Hits

Swiss-Prot: 90% identical to SUCC_BACTN: Succinate--CoA ligase [ADP-forming] subunit beta (sucC) from Bacteroides thetaiotaomicron (strain ATCC 29148 / DSM 2079 / NCTC 10582 / E50 / VPI-5482)

KEGG orthology group: K01903, succinyl-CoA synthetase beta subunit [EC: 6.2.1.5] (inferred from 90% identity to bth:BT_0788)

MetaCyc: 41% identical to malate thiokinase beta subunit (Methylorubrum extorquens AM1)
Malate--CoA ligase. [EC: 6.2.1.9]

Predicted SEED Role

"Succinyl-CoA ligase [ADP-forming] beta chain (EC 6.2.1.5)" in subsystem Serine-glyoxylate cycle or TCA Cycle (EC 6.2.1.5)

MetaCyc Pathways

• TCA cycle V (2-oxoglutarate synthase) (8/9 steps found)
• superpathway of cytosolic glycolysis (plants), pyruvate dehydrogenase and TCA cycle (17/22 steps found)
• reductive TCA cycle I (9/11 steps found)
• incomplete reductive TCA cycle (6/7 steps found)
• pyruvate fermentation to acetate VI (2/3 steps found)
• TCA cycle I (prokaryotic) (7/10 steps found)
• TCA cycle III (animals) (7/10 steps found)
• TCA cycle VIII (Chlamydia) (4/6 steps found)
• TCA cycle II (plants and fungi) (6/9 steps found)
• reductive TCA cycle II (8/12 steps found)
• superpathway of glycolysis, pyruvate dehydrogenase, TCA, and glyoxylate bypass (18/26 steps found)
• pyruvate fermentation to acetate V (1/3 steps found)
• anaerobic energy metabolism (invertebrates, mitochondrial) (6/10 steps found)
• formaldehyde assimilation I (serine pathway) (8/13 steps found)
• adipate degradation (2/5 steps found)
• superpathway of glyoxylate bypass and TCA (7/12 steps found)
• superpathway of anaerobic energy metabolism (invertebrates) (10/17 steps found)
• adipate biosynthesis (1/5 steps found)
• methylaspartate cycle (11/19 steps found)
• ethylmalonyl-CoA pathway (2/11 steps found)
• Methanobacterium thermoautotrophicum biosynthetic metabolism (21/56 steps found)

KEGG Metabolic Maps

• Biosynthesis of alkaloids derived from histidine and purine
• Biosynthesis of alkaloids derived from ornithine, lysine and nicotinic acid
• Biosynthesis of alkaloids derived from shikimate pathway
• Biosynthesis of alkaloids derived from terpenoid and polyketide
• Biosynthesis of phenylpropanoids
• Biosynthesis of plant hormones
• Biosynthesis of terpenoids and steroids
• C5-Branched dibasic acid metabolism
• Citrate cycle (TCA cycle)
• Glyoxylate and dicarboxylate metabolism
• Propanoate metabolism
• Reductive carboxylate cycle (CO2 fixation)

Isozymes

Compare fitness of predicted isozymes for: 6.2.1.5

Use Curated BLAST to search for 6.2.1.5 or 6.2.1.9

Protein Sequence (376 amino acids)

>BACOVA_02527 succinate-CoA ligase, beta subunit (Bacteroides ovatus ATCC 8483)
MKIHEYQAKEIFSKYGIPVERHTLCRTAAGVIAAYRRMGTDRVVIKAQVLTGGRGKAGGV
KLVNNTEDAYQEAKNILGMSIKGLPVNQVLVSEAVDIAAEYYVSYTIDRNTRSVVLMMSA
SGGMDIEEVARQTPEKIIRYSINPFIGLPDYLARRFAFSLFPQMEQAGKMAAILQELYKI
FMENDASLVEVNPLALTKKGTLMAIDAKIVFDDNALYRHPEVHALFDPTEEERIEADAKD
KGFSYVHMDGNIGCMVNGAGLAMATMDMIKLYGGQPANFLDIGGSSNPVKVIEAMKLLLQ
DEKVKVVLINIFGGITRCDDVAMGLLQAFEQINSNIPVIVRLTGTNEHIGRELLRNYSRF
QIATTMKEAALMALKA