Protein Info for BACOVA_02487 in Bacteroides ovatus ATCC 8483

Annotation: AbgT transporter family

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 485 signal peptide" amino acids 1 to 34 (34 residues), see Phobius details transmembrane" amino acids 68 to 88 (21 residues), see Phobius details amino acids 109 to 136 (28 residues), see Phobius details amino acids 147 to 164 (18 residues), see Phobius details amino acids 197 to 216 (20 residues), see Phobius details amino acids 246 to 272 (27 residues), see Phobius details amino acids 284 to 306 (23 residues), see Phobius details amino acids 326 to 347 (22 residues), see Phobius details amino acids 367 to 387 (21 residues), see Phobius details amino acids 393 to 414 (22 residues), see Phobius details amino acids 423 to 442 (20 residues), see Phobius details amino acids 458 to 479 (22 residues), see Phobius details PF03806: ABG_transport" amino acids 7 to 484 (478 residues), 436.6 bits, see alignment E=4.9e-135

Best Hits

KEGG orthology group: K12942, aminobenzoyl-glutamate transport protein (inferred from 93% identity to bth:BT_0751)

Predicted SEED Role

"Aminobenzoyl-glutamate transport protein" in subsystem p-Aminobenzoyl-Glutamate Utilization

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (485 amino acids)

>BACOVA_02487 AbgT transporter family (Bacteroides ovatus ATCC 8483)
MMKNKWRMPHPATMFLLLTMAVVFLSWICDIYGLKVTLPQTGEDIRVQSLLSPEGIRWWL
RNAIKNFTGFAPLGMVIIAMFGLGVAQHSGFIDACIRMGVGNRQEKRKIVLWVIVLGLLS
NAIGDGGYIILLPIAAMLFQWVGLHPIAGIVTAYVSVACGYSANIVLSTMDPLLAHTTQE
AALAQTGYQGNTEPLCNYFFMSASTVAITAIVYWITQKWLLPTLGKYEGSMKVVAYHPLS
RKERRAIMISIVVAAIYVALILWLTFSSYGILRGVNGGLMHSPFIAGILFLLSLGAGITG
MAYGFSSGRYRTDNDVIEGLTQPMKLLGVYFVIAFFAAQMFACFEYSHLDKCLAIMGADL
LSSFEPAPLSALVLFILFTALINLIMVSATSKWAFMSFIFIPMFAQMGIAPDIAQCAFRI
GDSSTNAITPFLFYMPLVLTYMRQYDKQITYGSLLKYTWRYSLGILVVWTLLFIVWYLLK
IPMGL