Protein Info for BACOVA_02472 in Bacteroides ovatus ATCC 8483

Annotation: undecaprenyl-phosphate glucose phosphotransferase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 468 transmembrane" amino acids 12 to 33 (22 residues), see Phobius details amino acids 39 to 61 (23 residues), see Phobius details amino acids 82 to 103 (22 residues), see Phobius details amino acids 109 to 127 (19 residues), see Phobius details amino acids 282 to 304 (23 residues), see Phobius details TIGR03025: exopolysaccharide biosynthesis polyprenyl glycosylphosphotransferase" amino acids 18 to 464 (447 residues), 418 bits, see alignment E=6.1e-129 TIGR03023: undecaprenyl-phosphate glucose phosphotransferase" amino acids 44 to 468 (425 residues), 456.4 bits, see alignment E=1.4e-140 PF13727: CoA_binding_3" amino acids 65 to 240 (176 residues), 90.5 bits, see alignment E=1.4e-29 PF02397: Bac_transf" amino acids 277 to 461 (185 residues), 223.3 bits, see alignment E=1.7e-70

Best Hits

KEGG orthology group: None (inferred from 80% identity to bth:BT_0480)

Predicted SEED Role

"Glycosyltransferase"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (468 amino acids)

>BACOVA_02472 undecaprenyl-phosphate glucose phosphotransferase (Bacteroides ovatus ATCC 8483)
MQEVQRFNKVLKSLVLFGDLILLNLLLWGFNLFLGTRFWCIHCGSIFQGMTLITLCYLLC
NMHSGVILHRPVVRPEQIMIRVLRNMVPFVFLSVCTLLVFHFHFSHSRYFGLFYVALIIV
IISYRLISRHFLELYRKKGGNVRKVVLVGSHENMQELYHAMTDDPTSGYRVLGYFEDFPS
GRYPQEVPYLGQPNEVSVFLEKHAGEINQLYCSLPSVRSAEIVPIINYCENHLVRFFSVP
NVRNYLKRRMHFELLGNVPVLSIRCEPLESLENRIIKRTFDVICSGLFLITVFPFVYIFF
GIAIKLSSPGPVFFKQKRSGEDGREFWCYKFRSMKVNTQCDTLQATENDPRKTRIGEIMR
KTSVDELPQFINVLKGDMSIVGPRPHMLKHTEEYSNLINKFMVRHFVKPGITGWAQVTGY
RGETKELWQMEGRVQRDIWYIEHWTFLLDLYIMYKTVYNAIRGEKEAY