Protein Info for BACOVA_02464 in Bacteroides ovatus ATCC 8483

Annotation: glycosyltransferase, group 1 family protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 378 PF13439: Glyco_transf_4" amino acids 17 to 188 (172 residues), 28.9 bits, see alignment E=1.7e-10 PF00534: Glycos_transf_1" amino acids 199 to 351 (153 residues), 104.9 bits, see alignment E=5.3e-34 PF13692: Glyco_trans_1_4" amino acids 204 to 340 (137 residues), 81.7 bits, see alignment E=9.5e-27

Best Hits

Predicted SEED Role

"Poly(glycerol-phosphate) alpha-glucosyltransferase (EC 2.4.1.52)" in subsystem Teichoic and lipoteichoic acids biosynthesis (EC 2.4.1.52)

MetaCyc Pathways

Isozymes

No predicted isozymes

Use Curated BLAST to search for 2.4.1.52

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (378 amino acids)

>BACOVA_02464 glycosyltransferase, group 1 family protein (Bacteroides ovatus ATCC 8483)
MKNILITFTNAIDPTTGGVERVYHNLVPYFREHGYNVFATYQRKTDYDKNSVYTKAIFME
YSIDNVGYFDKLDKVMMEMAVDIVICPFPSYQLFNYCSRLIDKKVFFHVHNVPSKLMYPS
SAKLPNILKESFVDRCLKRIRFDLRYLASFRRIELNKMKIVLLSDFFRDDLKSFYDFNPK
CICALPNPFCIDEEYQLDYQKKEKMILYVGRINTRQKRFQSLLNIWKRLQNELLDYRLEI
VGGGPEKELYENLAHEMRLKRITFHDFQNPTEYYKKAVCSCMTSNYEGFSMVLIEAMQYG
CVPFVFNSFASLPDIIDDKVNGYVITPFDEGEYVQKIKEFILLSKKNKEIISVKAMEKSR
EFDVRRVGQRWIELIDNY