Protein Info for BACOVA_02463 in Bacteroides ovatus ATCC 8483

Annotation: glycosyltransferase, group 1 family protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 405 transmembrane" amino acids 86 to 102 (17 residues), see Phobius details amino acids 251 to 269 (19 residues), see Phobius details PF00534: Glycos_transf_1" amino acids 206 to 366 (161 residues), 107 bits, see alignment E=1.2e-34 PF20706: GT4-conflict" amino acids 216 to 346 (131 residues), 27 bits, see alignment E=3.4e-10 PF13692: Glyco_trans_1_4" amino acids 221 to 366 (146 residues), 89.7 bits, see alignment E=3.3e-29

Best Hits

Predicted SEED Role

"Glycosyl transferase, group 1"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (405 amino acids)

>BACOVA_02463 glycosyltransferase, group 1 family protein (Bacteroides ovatus ATCC 8483)
MKRIAIMNNGTLPIPSVLGGAVETLVQLLVDTNEKEKQMQLEILSIDNVNAREKAKEYRY
THFHFVSTSSILNRMTDFLKRCYNFIALRTGLPFIGYCYASALVRFIKNCNNIDAVLLEG
SSINADYIKRKTALPVIQRIHNVPPHSLRHWDDLNAKSTDLYLGISNYICTVLQKNVEGK
YGAAIKLLYNSINFNQFNVRTTNEERHTLRKSLNIPANSFLFVFSGRLRNYKGIKELLLA
FLESKDKMPDAYLLIVGSFAFSSTYVSLFEKELASIIHQLGERVIFTGFVKYEVIHRYYQ
IANVGVFPSIWEEPFALTCLEAIASSLPVIITRSGGMPEIVNEECGIVVENDANLVNSLA
AAMENIYGMDKAKLENMAQHSVLRAQSFDNQLQYKQFVEYINSEI