Protein Info for BACOVA_02458 in Bacteroides ovatus ATCC 8483

Annotation: polysaccharide biosynthesis protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 511 transmembrane" amino acids 16 to 34 (19 residues), see Phobius details amino acids 46 to 68 (23 residues), see Phobius details amino acids 89 to 115 (27 residues), see Phobius details amino acids 127 to 149 (23 residues), see Phobius details amino acids 161 to 182 (22 residues), see Phobius details amino acids 188 to 207 (20 residues), see Phobius details amino acids 239 to 242 (4 residues), see Phobius details amino acids 315 to 335 (21 residues), see Phobius details amino acids 347 to 369 (23 residues), see Phobius details amino acids 379 to 400 (22 residues), see Phobius details amino acids 406 to 425 (20 residues), see Phobius details amino acids 441 to 460 (20 residues), see Phobius details amino acids 466 to 489 (24 residues), see Phobius details

Best Hits

KEGG orthology group: None (inferred from 63% identity to bfs:BF2791)

Predicted SEED Role

"FIG01281286: hypothetical protein"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (511 amino acids)

>BACOVA_02458 polysaccharide biosynthesis protein (Bacteroides ovatus ATCC 8483)
MSQATDNNKRIAKNTLLLYIRMLFMMIVSLYTSRVILDALGVEDFGIYNVVGGVVAMFSV
ISGSLSASISRFITFELGKGDQSKLNKIFSASVTIQILLSLIVVILIEIVGVWFLNSKMI
IPADRILAANWVLQFSVVTFVINLISVPYNASIIAHEKMSAFAYISILEAIGKLIIAYLI
VIAPMDKLVFYSILMCSVAIIIRFTYGYYCKRHFKECTYHFCWDKKLLKNMFGFAGWNFI
GAASSVLRDQGGNVVINLFFGPSVNAAKGIAMQVNSAISGFVSNFMTALNPQITKSYASG
NQDYMMALIFQGAKFSFYMLLLLSLPVIINTHYILGLWLKLVPEHAVLFVRLTLLFAMSE
SISNPLITAMLATGRIRNYQIMVGGLQMLNLPISYIFLRLGCVPESVLFVAIFISQCCLV
ARLYMLRGMIGLSSVKYLKHVYLKVLMVMSTSAILPILLLKNINETFLSFLVISVVSILT
TSISIFYIGCSKEERVFVWAKVSALCAKIRR