Protein Info for BACOVA_02425 in Bacteroides ovatus ATCC 8483

Annotation: hypothetical protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 206 signal peptide" amino acids 1 to 19 (19 residues), see Phobius details transmembrane" amino acids 31 to 52 (22 residues), see Phobius details amino acids 64 to 83 (20 residues), see Phobius details amino acids 89 to 110 (22 residues), see Phobius details amino acids 118 to 137 (20 residues), see Phobius details amino acids 155 to 170 (16 residues), see Phobius details amino acids 182 to 203 (22 residues), see Phobius details PF03956: Lys_export" amino acids 8 to 204 (197 residues), 231.2 bits, see alignment E=3.7e-73

Best Hits

KEGG orthology group: None (inferred from 95% identity to bth:BT_0722)

Predicted SEED Role

"putative surface protein"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (206 amino acids)

>BACOVA_02425 hypothetical protein (Bacteroides ovatus ATCC 8483)
MKGSLIVIVFFCVGCIMGAFNKFEFDTHTVSMYILYALMLQVGISIGSNKNLKAIVSHLH
PKMLLIPLGTIIGTLLFSALASLLLRQWSVFDCMAVGSGFAYYSLSSILITQFKEPSIGL
QLATELGTIALLTNIFREMMALLGTPIIKKYFGKLAPISAAGVNSMDVLLPSITRYSGKE
MIPIAILHGILIDISVPVFVSFFCNL