Protein Info for BACOVA_02414 in Bacteroides ovatus ATCC 8483

Annotation: ATP synthase, delta/epsilon subunit, beta-sandwich domain protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• TIGR01216: ATP synthase F1, epsilon subunit
  • amino acids 5 to 77 (73 residues), 69.7 bits, E=1.2e-23
• PF02823: ATP-synt_DE_N
  • amino acids 5 to 78 (74 residues), 79.6 bits, E=7e-27

Best Hits

Swiss-Prot: 42% identical to ATPE_CHLLI: ATP synthase epsilon chain (atpC) from Chlorobium limicola

KEGG orthology group: K02114, F-type H+-transporting ATPase subunit epsilon [EC: 3.6.3.14] (inferred from 90% identity to bth:BT_0712)

Predicted SEED Role

"ATP synthase epsilon chain (EC 3.6.3.14)" in subsystem F0F1-type ATP synthase (EC 3.6.3.14)

KEGG Metabolic Maps

• Oxidative phosphorylation
• Photosynthesis

Isozymes

Compare fitness of predicted isozymes for: 3.6.3.14

Use Curated BLAST to search for 3.6.3.14

Protein Sequence (82 amino acids)

>BACOVA_02414 ATP synthase, delta/epsilon subunit, beta-sandwich domain protein (Bacteroides ovatus ATCC 8483)
MMKELHLSIVSPEKSIFDGNVKIVTLPGMIGSFSILPGHAPIVSSLKAGTLSYTTMDGEE
HTMDIQGGFVEMSDGTVSACVS