Protein Info for BACOVA_02411 in Bacteroides ovatus ATCC 8483

Annotation: phosphoribosylglycinamide formyltransferase 2

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• TIGR01142: phosphoribosylglycinamide formyltransferase 2
  • amino acids 4 to 389 (386 residues), 504.3 bits, E=9.7e-156
• PF08443: RimK
  • amino acids 110 to 281 (172 residues), 24.6 bits, E=5.5e-09
• PF02786: CPSase_L_D2
  • amino acids 110 to 275 (166 residues), 39.6 bits, E=1.3e-13
• PF02222: ATP-grasp
  • amino acids 113 to 286 (174 residues), 183.9 bits, E=6.1e-58
• PF07478: Dala_Dala_lig_C
  • amino acids 127 to 277 (151 residues), 44.9 bits, E=3.1e-15
• PF02655: ATP-grasp_3
  • amino acids 135 to 277 (143 residues), 27.8 bits, E=7.4e-10
• PF21244: PurT_C
  • amino acids 314 to 386 (73 residues), 51.5 bits, E=1.7e-17

Best Hits

Swiss-Prot: 97% identical to PURT_BACTN: Formate-dependent phosphoribosylglycinamide formyltransferase (purT) from Bacteroides thetaiotaomicron (strain ATCC 29148 / DSM 2079 / NCTC 10582 / E50 / VPI-5482)

KEGG orthology group: K08289, phosphoribosylglycinamide formyltransferase 2 [EC: 2.1.2.2] (inferred from 97% identity to bth:BT_0704)

MetaCyc: 54% identical to phosphoribosylglycinamide formyltransferase 2 (Escherichia coli K-12 substr. MG1655)
GARTRANSFORMYL2-RXN [EC: 6.3.1.21]; Acetate kinase. [EC: 6.3.1.21, 2.7.2.1, 2.7.2.15]

Predicted SEED Role

"Phosphoribosylglycinamide formyltransferase 2 (EC 2.1.2.-)" in subsystem De Novo Purine Biosynthesis (EC 2.1.2.-)

MetaCyc Pathways

• superpathway of histidine, purine, and pyrimidine biosynthesis (42/46 steps found)
• superpathway of purine nucleotides de novo biosynthesis I (21/21 steps found)
• superpathway of purine nucleotides de novo biosynthesis II (23/26 steps found)
• superpathway of 5-aminoimidazole ribonucleotide biosynthesis (6/6 steps found)
• 5-aminoimidazole ribonucleotide biosynthesis I (5/5 steps found)
• 5-aminoimidazole ribonucleotide biosynthesis II (5/5 steps found)
• superpathway of tetrahydrofolate biosynthesis and salvage (10/12 steps found)
• Bifidobacterium shunt (12/15 steps found)
• superpathway of N-acetylneuraminate degradation (17/22 steps found)
• pyruvate fermentation to acetate I (3/3 steps found)
• pyruvate fermentation to acetate IV (3/3 steps found)
• pyruvate fermentation to acetate VII (3/3 steps found)
• superpathway of acetate utilization and formation (3/3 steps found)
• L-threonine degradation I (5/6 steps found)
• (S)-lactate fermentation to propanoate, acetate and hydrogen (10/13 steps found)
• acetate and ATP formation from acetyl-CoA I (2/2 steps found)
• tetrahydrofolate salvage from 5,10-methenyltetrahydrofolate (2/2 steps found)
• reductive glycine pathway of autotrophic CO₂ fixation (7/9 steps found)
• superpathway of fermentation (Chlamydomonas reinhardtii) (7/9 steps found)
• mixed acid fermentation (12/16 steps found)
• hexitol fermentation to lactate, formate, ethanol and acetate (14/19 steps found)
• pyruvate fermentation to acetate and lactate II (3/4 steps found)
• superpathway of L-threonine metabolism (13/18 steps found)
• pyruvate fermentation to acetate II (2/3 steps found)
• glycine degradation (reductive Stickland reaction) (1/2 steps found)
• (S)-propane-1,2-diol degradation (3/5 steps found)
• acetylene degradation (anaerobic) (3/5 steps found)
• ethanolamine utilization (3/5 steps found)
• lactate fermentation to acetate, CO₂ and hydrogen (Desulfovibrionales) (5/8 steps found)
• pyruvate fermentation to acetate and (S)-lactate I (2/4 steps found)
• superpathway of Clostridium acetobutylicum acidogenic fermentation (5/9 steps found)
• methanogenesis from acetate (2/6 steps found)
• superpathway of L-alanine fermentation (Stickland reaction) (4/9 steps found)
• acetyl-CoA fermentation to butanoate (2/7 steps found)
• L-lysine fermentation to acetate and butanoate (3/10 steps found)
• superpathway of Clostridium acetobutylicum acidogenic and solventogenic fermentation (7/17 steps found)
• purine nucleobases degradation II (anaerobic) (12/24 steps found)
• purine nucleobases degradation I (anaerobic) (5/15 steps found)
• gallate degradation III (anaerobic) (2/11 steps found)
• superpathway of methanogenesis (2/21 steps found)
• superpathway of L-lysine degradation (6/43 steps found)

KEGG Metabolic Maps

• Nucleotide sugars metabolism
• One carbon pool by folate
• Propanoate metabolism
• Purine metabolism
• Pyruvate metabolism
• Taurine and hypotaurine metabolism

Isozymes

Compare fitness of predicted isozymes for: 2.1.2.2, 2.7.2.1

Use Curated BLAST to search for 2.1.2.- or 2.1.2.2 or 2.7.2.1 or 2.7.2.15 or 6.3.1.21

Protein Sequence (389 amino acids)

>BACOVA_02411 phosphoribosylglycinamide formyltransferase 2 (Bacteroides ovatus ATCC 8483)
MMKKILLLGSGELGKEFVISAQRKGQHIIACDSYAGAPAMQVADEFEVFDMLNGEELERV
VKKHHPDIIVPEIEAIRTERLYDFEKEGIQVVPSARAVNFTMNRKAIRDLAAQELGLKTA
KYFYAKTLEELKEAADKIGFPCVVKPLMSSSGKGQSLVKSADELEHAWEYGCSGSRGDIR
ELIIEEFIKFDSEITLLTVTQKNGPTLFCPPIGHVQKGGDYRESFQPAHIDPAHLKEAEE
MAEKVTRALTGAGLWGVEFFLSHDNGVYFSELSPRPHDTGMVTLAGTQNLNEFELHLRAV
LGLPIPGIKQERIGASAVILSPIASQERPQYRGLEEVTKEEDTYLRIFGKPFTRVNRRMG
VVLCYAPLDSDLDALRDKAKRIAEKVEVH