Protein Info for BACOVA_02403 in Bacteroides ovatus ATCC 8483

Annotation: transporter, major facilitator family protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 385 transmembrane" amino acids 10 to 31 (22 residues), see Phobius details amino acids 47 to 68 (22 residues), see Phobius details amino acids 75 to 94 (20 residues), see Phobius details amino acids 100 to 124 (25 residues), see Phobius details amino acids 137 to 157 (21 residues), see Phobius details amino acids 164 to 186 (23 residues), see Phobius details amino acids 206 to 227 (22 residues), see Phobius details amino acids 243 to 263 (21 residues), see Phobius details amino acids 270 to 287 (18 residues), see Phobius details amino acids 293 to 317 (25 residues), see Phobius details amino acids 330 to 351 (22 residues), see Phobius details amino acids 358 to 379 (22 residues), see Phobius details PF07690: MFS_1" amino acids 14 to 342 (329 residues), 78.1 bits, see alignment E=6.5e-26 PF00083: Sugar_tr" amino acids 42 to 179 (138 residues), 26.6 bits, see alignment E=2.8e-10

Best Hits

KEGG orthology group: None (inferred from 81% identity to bth:BT_0699)

Predicted SEED Role

"Major facilitator family transporter"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (385 amino acids)

>BACOVA_02403 transporter, major facilitator family protein (Bacteroides ovatus ATCC 8483)
MAVKLWTVHFMRICVANLLLFISLYVLFPVLSVEMADRLGVPAAQTGVIFLFFTLGMFLI
GPFHAYLVDAYKRKYVCMFAAVLMVVATIGYAFVTNLTELILLGTVQGLAFGIGTTAGIT
LAIDITNSTLRSAGNVSFSWMARMGMIAGIILGVWLYQSQSFQTLLTVSVITGAVGILML
SGVYVPFRAPIVTKLYSFDRFLLLRGWVPAINLILITFIPGLLVPMVHPFLNDFVLGNTG
IPVPFFVGTALGYIVSLFFARLFFLKEKTLRLVIIGLGLEIVAISLLNTDISIGISSVLL
GLGLGFILPEFLVMFVKLSHHCQRGTANTTHLLATEIGISLGIATACYMELDTDKMLHTG
QIVASIALLFFALITYPYYIKKKVR