Protein Info for BACOVA_02363 in Bacteroides ovatus ATCC 8483

Annotation: superoxide dismutase, Mn/Fe family

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• PF00081: Sod_Fe_N
  • amino acids 14 to 93 (80 residues), 101.8 bits, E=2.3e-33
• PF02777: Sod_Fe_C
  • amino acids 103 to 204 (102 residues), 139 bits, E=5e-45

Best Hits

Swiss-Prot: 93% identical to SODF_BACFR: Superoxide dismutase [Fe] (sodB) from Bacteroides fragilis (strain YCH46)

KEGG orthology group: K04564, superoxide dismutase, Fe-Mn family [EC: 1.15.1.1] (inferred from 98% identity to bth:BT_0655)

MetaCyc: 48% identical to superoxide dismutase (Fe) (Escherichia coli K-12 substr. MG1655)
Superoxide dismutase. [EC: 1.15.1.1]

Predicted SEED Role

"Superoxide dismutase [Fe] (EC 1.15.1.1)" in subsystem Oxidative stress (EC 1.15.1.1)

MetaCyc Pathways

• reactive oxygen species degradation (4/4 steps found)
• superoxide radicals degradation (2/2 steps found)
• ethene biosynthesis III (microbes) (5/7 steps found)

Isozymes

No predicted isozymes

Use Curated BLAST to search for 1.15.1.1

Protein Sequence (205 amino acids)

>BACOVA_02363 superoxide dismutase, Mn/Fe family (Bacteroides ovatus ATCC 8483)
MNTILMSLIMMTMTYEMPKLPYANNALEPVISQQTIDFHYGKHLQTYVNNLNSLVPGTEY
EGKTVEEIVAAAPDGAIFNNAGQVLNHNLYFLQFAPKPSKKEPAGKLGEAIKRDFGSFEN
FKKEFNAAAVGLFGSGWAWLSVDKDGKLKITKEGNGSNPVRAGLKPLLGFDVWEHSYYLD
YQNRRADHVNALWDIIDWDVVEKRM