Protein Info for BACOVA_02358 in Bacteroides ovatus ATCC 8483

Annotation: thiamine biosynthesis protein ThiC

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 565 PF13667: ThiC-associated" amino acids 6 to 88 (83 residues), 102.9 bits, see alignment E=6.4e-34 TIGR00190: phosphomethylpyrimidine synthase" amino acids 127 to 558 (432 residues), 682.2 bits, see alignment E=1.3e-209 PF01964: ThiC_Rad_SAM" amino acids 128 to 555 (428 residues), 612 bits, see alignment E=5.4e-188

Best Hits

Swiss-Prot: 97% identical to THIC_BACTN: Phosphomethylpyrimidine synthase (thiC) from Bacteroides thetaiotaomicron (strain ATCC 29148 / DSM 2079 / NCTC 10582 / E50 / VPI-5482)

KEGG orthology group: K03147, thiamine biosynthesis protein ThiC (inferred from 97% identity to bth:BT_0650)

Predicted SEED Role

"Hydroxymethylpyrimidine phosphate synthase ThiC (EC 4.1.99.17)" (EC 4.1.99.17)

MetaCyc Pathways

Isozymes

No predicted isozymes

Use Curated BLAST to search for 4.1.99.17

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (565 amino acids)

>BACOVA_02358 thiamine biosynthesis protein ThiC (Bacteroides ovatus ATCC 8483)
MEQKIKFPRSQKVYLPGKLYPNIRVAMRKVEQVPSVSFEGEEKIATPNPEIYVYDTSGPF
SDADMSIDLKKGLPRMREEWIVGRGDVEQLPEITSEYGQMRRDDKSLDHLRFEHIALPYR
AKKGEAITQMAYAKRGIITPEMEYVAIRENMNCEELGIKTHITPEFVRQEIAEGRAVLPA
NINHPEAEPMIIGRNFLVKINTNIGNSATTSSIDEEVEKALWSCKWGGDTLMDLSTGENI
HETREWIIRNCPVPVGTVPIYQALEKVNGIVEDLTWEIYRDTLIEQCEQGVDYFTIHAGI
RRHNVHLADKRLCGIVSRGGSIMSKWCLVHDQESFLYDHFDDICDILAQYDVAVSLGDGL
RPGSIYDANDEAQFAELDTMGELVLRAWDKNVQAFIEGPGHVPMHKIKENMERQIEKCHD
APFYTLGPLVTDIAPGYDHITSAIGAAQIGWLGTAMLCYVTPKEHLALPDKEDVRVGVIT
YKIAAHAADLAKGHPGAQVRDNALSKARYEFRWKDQFDLSLDPERAQTYFRAGHHIDGEY
CTMCGPNFCAMRLSRDLKKSTKNNK