Protein Info for BACOVA_02039 in Bacteroides ovatus ATCC 8483

Annotation: hypothetical protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 361 transmembrane" amino acids 7 to 24 (18 residues), see Phobius details amino acids 50 to 70 (21 residues), see Phobius details amino acids 84 to 102 (19 residues), see Phobius details amino acids 114 to 134 (21 residues), see Phobius details amino acids 141 to 159 (19 residues), see Phobius details amino acids 196 to 217 (22 residues), see Phobius details amino acids 228 to 246 (19 residues), see Phobius details amino acids 258 to 277 (20 residues), see Phobius details amino acids 297 to 315 (19 residues), see Phobius details amino acids 335 to 353 (19 residues), see Phobius details

Best Hits

KEGG orthology group: None (inferred from 45% identity to pru:PRU_1851)

Predicted SEED Role

"N-acetylglucosamine related transporter, NagX" in subsystem Chitin and N-acetylglucosamine utilization

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (361 amino acids)

>BACOVA_02039 hypothetical protein (Bacteroides ovatus ATCC 8483)
MNPNKRLLSLDVLRGITVAGMILVNNTGKCGYNFAAFAHAKWDGFSPADLVFPMFMFLMG
ISTYISLCKYNFQCRPAIAKIIKRSLLLIFIGLVMEWFITAIDSGNYFDLSQLRLMGVMQ
RLGICYGITALLAVTIPHKRFMPLAIILLAVYFIFQLFGNGFEKSADNIVGMIDSAILGS
NHMYLQGRQFVDPEGILSTIPAVSQVMIGFVCGKIIIDIKDNDRRMLNLFLIGTTLLFVG
YLLSYACPLNKRLWSPSFVLLTCGIAALSLALLLYIIDVKQNKKWFSFFEAFGANPLVIY
VFSCIAGGLLVHWHIHTAVFNNLLNPLFGNYFGSFMYGVFFLLFNGLLGYILLKRKIYIK
L