Protein Info for BACOVA_01655 in Bacteroides ovatus ATCC 8483

Annotation: ribosomal protein L11 methyltransferase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• PF06325: PrmA
  • amino acids 40 to 278 (239 residues), 164.2 bits, E=1.5e-51
• PF05175: MTS
  • amino acids 122 to 217 (96 residues), 37.3 bits, E=6.9e-13
• PF13489: Methyltransf_23
  • amino acids 134 to 217 (84 residues), 32.6 bits, E=2e-11
• PF13847: Methyltransf_31
  • amino acids 144 to 235 (92 residues), 37.1 bits, E=7.7e-13
• PF13649: Methyltransf_25
  • amino acids 149 to 232 (84 residues), 30.9 bits, E=1.1e-10

Best Hits

Swiss-Prot: 89% identical to PRMA_BACTN: Ribosomal protein L11 methyltransferase (prmA) from Bacteroides thetaiotaomicron (strain ATCC 29148 / DSM 2079 / NCTC 10582 / E50 / VPI-5482)

KEGG orthology group: K02687, ribosomal protein L11 methyltransferase [EC: 2.1.1.-] (inferred from 89% identity to bth:BT_0314)

Predicted SEED Role

"Ribosomal protein L11 methyltransferase (EC 2.1.1.-)" in subsystem Heat shock dnaK gene cluster extended or Ribosome biogenesis bacterial (EC 2.1.1.-)

KEGG Metabolic Maps

• Alkaloid biosynthesis I
• Anthocyanin biosynthesis
• Benzoxazinone biosynthesis
• Biosynthesis of alkaloids derived from shikimate pathway
• Carotenoid biosynthesis - General
• Flavonoid biosynthesis
• Histidine metabolism
• Insect hormone biosynthesis
• Naphthalene and anthracene degradation
• Phenylpropanoid biosynthesis
• Porphyrin and chlorophyll metabolism
• Tryptophan metabolism
• Tyrosine metabolism
• Ubiquinone and menaquinone biosynthesis

Isozymes

Compare fitness of predicted isozymes for: 2.1.1.-

Use Curated BLAST to search for 2.1.1.-

Protein Sequence (282 amino acids)

>BACOVA_01655 ribosomal protein L11 methyltransferase (Bacteroides ovatus ATCC 8483)
MKYFEFTFRTHPCTEIVTDVLAAVLGEVGFESFVECEGGLTAYIQQTICDENAIKIAITE
FPLPDTDITYTYTEAEDKDWNEEWEKNFFQPIIIGNRCVIHSTFHQDVPKAEYDIVINPQ
MAFGTGHHETTSLIIEELLDSELKDKSLLDMGCGTSILAILARMRGARPCTAIDIDEWCV
RNSIENIELNHVDDIAVSQGDASSLTGKGPFDVIIANINRNILLNDMKQYVACMHTDSEL
YMSGFYVDDIAAIREEAEKNGLTFVHYKEKNRWAEVKFVYKG