Protein Info for BACOVA_01650 in Bacteroides ovatus ATCC 8483

Annotation: dihydrolipoyl dehydrogenase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• TIGR01350: dihydrolipoyl dehydrogenase
  • amino acids 2 to 445 (444 residues), 460.2 bits, E=3.6e-142
• PF07992: Pyr_redox_2
  • amino acids 3 to 318 (316 residues), 238.9 bits, E=5e-74
• PF12831: FAD_oxidored
  • amino acids 4 to 48 (45 residues), 28.4 bits, 6.8e-10
• PF00890: FAD_binding_2
  • amino acids 4 to 36 (33 residues), 20.9 bits, see alignment (E = 1.1e-07)
• PF13738: Pyr_redox_3
  • amino acids 7 to 302 (296 residues), 44.6 bits, E=6.9e-15
• PF00070: Pyr_redox
  • amino acids 173 to 241 (69 residues), 75.3 bits, E=2.8e-24
• PF02852: Pyr_redox_dim
  • amino acids 337 to 444 (108 residues), 100.3 bits, E=4.4e-32

Best Hits

KEGG orthology group: K00382, dihydrolipoamide dehydrogenase [EC: 1.8.1.4] (inferred from 88% identity to bth:BT_0309)

Predicted SEED Role

"Dihydrolipoamide dehydrogenase of acetoin dehydrogenase (EC 1.8.1.4)" in subsystem Acetoin, butanediol metabolism (EC 1.8.1.4)

MetaCyc Pathways

• superpathway of cytosolic glycolysis (plants), pyruvate dehydrogenase and TCA cycle (17/22 steps found)
• glycine biosynthesis II (3/3 steps found)
• glycine cleavage (3/3 steps found)
• 2-oxoglutarate decarboxylation to succinyl-CoA (2/3 steps found)
• 2-oxoisovalerate decarboxylation to isobutanoyl-CoA (2/3 steps found)
• pyruvate decarboxylation to acetyl CoA I (2/3 steps found)

KEGG Metabolic Maps

• Biosynthesis of alkaloids derived from histidine and purine
• Biosynthesis of alkaloids derived from ornithine, lysine and nicotinic acid
• Biosynthesis of alkaloids derived from shikimate pathway
• Biosynthesis of alkaloids derived from terpenoid and polyketide
• Biosynthesis of phenylpropanoids
• Biosynthesis of plant hormones
• Biosynthesis of terpenoids and steroids
• Citrate cycle (TCA cycle)
• Glycine, serine and threonine metabolism
• Glycolysis / Gluconeogenesis
• Pyruvate metabolism
• Valine, leucine and isoleucine degradation

Isozymes

Compare fitness of predicted isozymes for: 1.8.1.4

Use Curated BLAST to search for 1.8.1.4

Protein Sequence (447 amino acids)

>BACOVA_01650 dihydrolipoyl dehydrogenase (Bacteroides ovatus ATCC 8483)
MNFDIAIIGGGPAGYTAAERAGANGLKTVLFEKKAMGGVCLNEGCIPTKTLLYSAKILDS
IKSASKYGVSAESPSFDLSKIMSRKDKTVKMLTGGVKMTVSSYGVTIIEKEALIEGEKEG
KIQITCDGETYSVKYLLVCTGSDTVIPPIPGLSEISYWTSKEALEIKELPKTLVIIGGGV
IGMEFASFFNSMGVKVHVVEMMPEILGAMDKETSGMLRAEYAKRGVTFYLNTKVVEVNPH
GVVIEKEGKMSAIEAEKILLSVGRKANLSKVGLDKLNIELHRNGVKVDEHLLTSHPRVYA
CGDITGYSLLAHTAIREAEVAINHILGVEDRMNYDCVPGVVYTNPEVAGVGKTEEELVKS
GIPYRISKLPMAYSGRFVAENEQGNGLCKLIQDEDGKIIGCHMLGNPASELIVIAGIAIQ
RGYTVEEFQKTVFPHPTVGEIYHEIMF