Protein Info for BACOVA_01643 in Bacteroides ovatus ATCC 8483

Annotation: prokaryotic transcription elongation factor, GreA/GreB domain protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• PF03449: GreA_GreB_N
  • amino acids 25 to 94 (70 residues), 101.1 bits, E=3e-33
• TIGR01462: transcription elongation factor GreA
  • amino acids 25 to 174 (150 residues), 179.5 bits, E=2.2e-57
• PF01272: GreA_GreB
  • amino acids 102 to 175 (74 residues), 83.8 bits, E=6.7e-28

Best Hits

Swiss-Prot: 59% identical to GREA_GRAFK: Transcription elongation factor GreA (greA) from Gramella forsetii (strain KT0803)

KEGG orthology group: K03624, transcription elongation factor GreA (inferred from 97% identity to bth:BT_2565)

Predicted SEED Role

"Transcription elongation factor GreA" in subsystem Transcription factors bacterial

Protein Sequence (176 amino acids)

>BACOVA_01643 prokaryotic transcription elongation factor, GreA/GreB domain protein (Bacteroides ovatus ATCC 8483)
MAHVGILFCLYDHLKQLKEENIMAYMSEEGYKKLMAELKELETVERPKISAAIAEARDKG
DLSENAEYDAAKEAQGMLEMRINKLKATIADAKIIDESKLKTDSVQILNKVELKNVKNGM
KMIYTIVSESEANLKEGKISVNTPIAQGLLGKKVGDVAEITVPQGKIALEVVNISI