Protein Info for BACOVA_01443 in Bacteroides ovatus ATCC 8483

Annotation: dTDP-glucose 4,6-dehydratase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 378 TIGR01181: dTDP-glucose 4,6-dehydratase" amino acids 4 to 362 (359 residues), 457.6 bits, see alignment E=1e-141 PF04321: RmlD_sub_bind" amino acids 4 to 199 (196 residues), 32.6 bits, see alignment E=1.4e-11 PF01370: Epimerase" amino acids 5 to 257 (253 residues), 221.5 bits, see alignment E=3.3e-69 PF02719: Polysacc_synt_2" amino acids 5 to 117 (113 residues), 44.3 bits, see alignment E=4.2e-15 PF16363: GDP_Man_Dehyd" amino acids 5 to 348 (344 residues), 286.8 bits, see alignment E=8.4e-89 PF01073: 3Beta_HSD" amino acids 5 to 116 (112 residues), 33 bits, see alignment E=9.9e-12 PF07993: NAD_binding_4" amino acids 6 to 194 (189 residues), 36.9 bits, see alignment E=7e-13

Best Hits

KEGG orthology group: K01710, dTDP-glucose 4,6-dehydratase [EC: 4.2.1.46] (inferred from 94% identity to bth:BT_2016)

Predicted SEED Role

"dTDP-glucose 4,6-dehydratase (EC 4.2.1.46)" in subsystem Rhamnose containing glycans or dTDP-rhamnose synthesis or linker unit-arabinogalactan synthesis (EC 4.2.1.46)

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

Compare fitness of predicted isozymes for: 4.2.1.46

Use Curated BLAST to search for 4.2.1.46

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (378 amino acids)

>BACOVA_01443 dTDP-glucose 4,6-dehydratase (Bacteroides ovatus ATCC 8483)
MKTYLVTGAAGFIGANYIKYILAKHNDIKVVILDALTYAGNLGTIAKDIDNERCVFIKGD
ICSRDVVDGLFAEYRFDYVVNFAAESHVDRSIENPQLFLITNILGTQNLLDCARRAWVMG
KDEQGYPTWRKGVRYHQVSTDEVYGSLGAEGYFTEATPLCPHSPYSASKTSADMVVMAYH
DTYKMPVTITRCSNNYGPYHFPEKLIPLIIKNILEGKHLPVYGDGSNVRDWLYVEDHCKA
IDLVVREGQDGEVYNVGGHNEKTNLEIVKLTISTIHRLMAENPEYRQVLKKKVKDENGDI
SIEWINEDLITFVKDRLGHDQRYAIDPTKITNALGWYPETKFEVGIVKTIEWYLANQAWV
EEVTSGDYQGYYEKMYGK