Protein Info for BACOVA_01376 in Bacteroides ovatus ATCC 8483

Annotation: hypothetical protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 537 transmembrane" amino acids 26 to 47 (22 residues), see Phobius details amino acids 59 to 79 (21 residues), see Phobius details amino acids 93 to 118 (26 residues), see Phobius details amino acids 146 to 166 (21 residues), see Phobius details amino acids 178 to 198 (21 residues), see Phobius details amino acids 210 to 233 (24 residues), see Phobius details amino acids 245 to 265 (21 residues), see Phobius details amino acids 281 to 300 (20 residues), see Phobius details amino acids 321 to 340 (20 residues), see Phobius details amino acids 347 to 367 (21 residues), see Phobius details amino acids 386 to 403 (18 residues), see Phobius details amino acids 416 to 439 (24 residues), see Phobius details amino acids 482 to 502 (21 residues), see Phobius details

Best Hits

KEGG orthology group: None (inferred from 71% identity to bsa:Bacsa_2047)

Predicted SEED Role

No annotation

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (537 amino acids)

>BACOVA_01376 hypothetical protein (Bacteroides ovatus ATCC 8483)
MSAPVLNGPFVLPMFRSFVPRKMQPWIYLFIAVTFQLSGGVYLGALNQMIGSMSLMREDI
LMCMYANLAGMAIYFPLLFRMKFRFTNKTLLTSAALGVLLCNLIAPHITFLPLLWLVCFI
EGMCKIQGTFECMSNIQLWMTPKREFTVFFPWLHIVILGSIQLSDLITTRLMYHYHWTYM
NLFVAGLMLIVLLIQFTCVKHFRFMRKFPLFGIDWLGGILWAALLAEIAFLFNYGDWYDW
WNSPVIRQLTIVIFITLGICIWRMMTIRHPFLEPKMWTYRHFLPLLGLVTLVEAFLATEH
VLEEVFYEEVMKYEELVSSQLDWLAIVGIVCGCVFSYWWMHVKQYNYVRLVIVGFIGLIG
YLIGFYLTLSTDIHISQLYLPTVCRGFAYAVLSATFMVCLEEIMTFQHFFQGLSVFNMLH
MVVGGVVGAAVYAQGLAYYVPDNLARYGSAIDHVAFSSSPFNLGHYMEEFISQMMEISIK
QIYGWVAYACIFLFLLLLLYDFPVRRSLKSMPSWKEVAREVKNTFWRTTHMPSEKEK