Protein Info for BACOVA_01375 in Bacteroides ovatus ATCC 8483

Annotation: hypothetical protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 371 transmembrane" amino acids 9 to 29 (21 residues), see Phobius details amino acids 49 to 69 (21 residues), see Phobius details amino acids 81 to 100 (20 residues), see Phobius details amino acids 112 to 134 (23 residues), see Phobius details amino acids 141 to 160 (20 residues), see Phobius details amino acids 200 to 220 (21 residues), see Phobius details amino acids 231 to 250 (20 residues), see Phobius details amino acids 262 to 282 (21 residues), see Phobius details amino acids 302 to 320 (19 residues), see Phobius details amino acids 341 to 363 (23 residues), see Phobius details PF07786: HGSNAT_cat" amino acids 5 to 230 (226 residues), 28.7 bits, see alignment E=9.3e-11 PF16401: DUF5009" amino acids 7 to 172 (166 residues), 32.9 bits, see alignment E=5e-12

Best Hits

Predicted SEED Role

"N-acetylglucosamine related transporter, NagX" in subsystem Chitin and N-acetylglucosamine utilization

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (371 amino acids)

>BACOVA_01375 hypothetical protein (Bacteroides ovatus ATCC 8483)
MKSERLLSLDILRGITIVGMILVNNPGTWESIYAPLRHAEWNGLTPTDLVFPFFMFIMGV
SMSFALSRFDHHFSRGFIIKLVRRTVILFLLGLFLSWFSLVCTGVEQPFSHIRILGVLQR
LALAYFFGSLLIVGVRRPANLAWISGIILAGYSILLALGHGFELSEQNIIAVTDRTLFGE
AHLYREWLPDGGRIFFDPEGLLSTLPCIAQVIIGYFCGNILREKTEIHHRLLQISILGIA
LLFAGWLLSYGCPLNKKVWSPTFVLVTCGFASLLLVFLTWLIDIRKKQKWGYPFHVFGTN
PLFIYIVAGVLATLLEVITVGESSLQEKIYTSIWSVLPDAHLASLIYALLFIGFNYLIVW
GLYKKQLFIKI