Protein Info for BACOVA_01155 in Bacteroides ovatus ATCC 8483

Annotation: triose-phosphate isomerase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• TIGR00419: triose-phosphate isomerase
  • amino acids 5 to 239 (235 residues), 213.4 bits, E=2e-67
• PF00121: TIM
  • amino acids 5 to 249 (245 residues), 323.6 bits, E=4.4e-101

Best Hits

Swiss-Prot: 99% identical to TPIS_BACTN: Triosephosphate isomerase (tpiA) from Bacteroides thetaiotaomicron (strain ATCC 29148 / DSM 2079 / NCTC 10582 / E50 / VPI-5482)

KEGG orthology group: K01803, triosephosphate isomerase (TIM) [EC: 5.3.1.1] (inferred from 99% identity to bth:BT_3929)

MetaCyc: 45% identical to triosephosphate isomerase subunit (Lactobacillus delbrueckii bulgaricus)
Triose-phosphate isomerase. [EC: 5.3.1.1]

Predicted SEED Role

"Triosephosphate isomerase (EC 5.3.1.1)" in subsystem Calvin-Benson cycle or Glycolysis and Gluconeogenesis or Glycolysis and Gluconeogenesis, including Archaeal enzymes or MLST (EC 5.3.1.1)

MetaCyc Pathways

• glycolysis III (from glucose) (11/11 steps found)
• homolactic fermentation (11/12 steps found)
• glycolysis II (from fructose 6-phosphate) (10/11 steps found)
• glycolysis IV (9/10 steps found)
• superpathway of glycolysis and the Entner-Doudoroff pathway (14/17 steps found)
• gluconeogenesis I (11/13 steps found)
• glycolysis I (from glucose 6-phosphate) (11/13 steps found)
• formaldehyde assimilation III (dihydroxyacetone cycle) (10/12 steps found)
• gluconeogenesis III (10/12 steps found)
• superpathway of N-acetylneuraminate degradation (17/22 steps found)
• superpathway of cytosolic glycolysis (plants), pyruvate dehydrogenase and TCA cycle (17/22 steps found)
• hexitol fermentation to lactate, formate, ethanol and acetate (14/19 steps found)
• superpathway of anaerobic sucrose degradation (14/19 steps found)
• glycolysis VI (from fructose) (8/11 steps found)
• superpathway of hexitol degradation (bacteria) (13/18 steps found)
• Calvin-Benson-Bassham cycle (9/13 steps found)
• superpathway of glycolysis, pyruvate dehydrogenase, TCA, and glyoxylate bypass (18/26 steps found)
• glycolysis V (Pyrococcus) (6/10 steps found)
• sucrose degradation V (sucrose α-glucosidase) (2/5 steps found)
• ethene biosynthesis V (engineered) (15/25 steps found)
• oxygenic photosynthesis (9/17 steps found)
• glycerol degradation to butanol (8/16 steps found)
• gluconeogenesis II (Methanobacterium thermoautotrophicum) (8/18 steps found)
• 1-butanol autotrophic biosynthesis (engineered) (13/27 steps found)
• photosynthetic 3-hydroxybutanoate biosynthesis (engineered) (12/26 steps found)
• Methanobacterium thermoautotrophicum biosynthetic metabolism (21/56 steps found)

KEGG Metabolic Maps

• Carbon fixation in photosynthetic organisms
• Fructose and mannose metabolism
• Glycolysis / Gluconeogenesis
• Inositol phosphate metabolism

Isozymes

Compare fitness of predicted isozymes for: 5.3.1.1

Use Curated BLAST to search for 5.3.1.1

Protein Sequence (251 amino acids)

>BACOVA_01155 triose-phosphate isomerase (Bacteroides ovatus ATCC 8483)
MRKNIVAGNWKMNKTLQEGIALAKELNEALANEKPNCDVIICTPFIHLASVTPLVDAAKI
GVGAENCADKASGAYTGEVSAEMVASTGAKYVILGHSERRAYYGETVAILEEKVKLALAN
GLTPIFCIGEVLEEREANKQNEVVAAQMESVFSLSAEDFSKIVLAYEPVWAIGTGKTASP
EQAQEIHAFIRSIVANKYGKEIADNTSILYGGSCKPSNAKELFANPDVDGGLIGGAALKV
SDFKGIIDAFN