Protein Info for BACOVA_01058 in Bacteroides ovatus ATCC 8483

Annotation: glutamate--tRNA ligase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 505 TIGR00464: glutamate--tRNA ligase" amino acids 5 to 499 (495 residues), 476.5 bits, see alignment E=5e-147 PF00749: tRNA-synt_1c" amino acids 5 to 343 (339 residues), 308.9 bits, see alignment E=3.4e-96 PF19269: Anticodon_2" amino acids 360 to 500 (141 residues), 104.8 bits, see alignment E=5.2e-34

Best Hits

Swiss-Prot: 97% identical to SYE_BACTN: Glutamate--tRNA ligase (gltX) from Bacteroides thetaiotaomicron (strain ATCC 29148 / DSM 2079 / NCTC 10582 / E50 / VPI-5482)

KEGG orthology group: K01885, glutamyl-tRNA synthetase [EC: 6.1.1.17] (inferred from 97% identity to bth:BT_2748)

Predicted SEED Role

"Glutamyl-tRNA synthetase (EC 6.1.1.17)" in subsystem Heme and Siroheme Biosynthesis or tRNA aminoacylation, Glu and Gln (EC 6.1.1.17)

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

No predicted isozymes

Use Curated BLAST to search for 6.1.1.17

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (505 amino acids)

>BACOVA_01058 glutamate--tRNA ligase (Bacteroides ovatus ATCC 8483)
MAERKVRVRFAPSPTGALHIGGVRTALYNYLFARQHGGDLIFRIEDTDSNRFVPGAEEYI
LESFKWLGIHFDEGVSFGGEQGPYRQSERREIYKKYVQILLENGKAYIAFDTPEELDAKR
AEIANFQYDASTRGMMRNSLTMPKEEVDALIAEGKQYVVRFKIEPNEDIHVNDLIRGEVV
INSSILDDKVLYKSADELPTYHLANIVDDHLMEVSHVIRGEEWLPSAPLHVLLYRAFGWE
DTMPEFAHLPLLLKPEGNGKLSKRDGDRLGFPVFPLEWHDPKSGEISSGYRESGYLPEAV
INFLALLGWNPGNDQEVMSMDELIKLFDLHRCSKSGAKFDYKKGIWFNHQYIQQKPNEEI
AELFLPFLKEQGVEAPFEKVVTVVGMMKDRVSFIKELWDVCSFFFVAPTEYDEKTVKKRW
KEDSAKCMTELAEVIAGIEDFSIEGQEKVVMDWIAEKGYHTGNIMNAFRLTLVGEGKGPH
MFDISWVLGKEETIARMKRAVEVLK