Protein Info for BACOVA_01050 in Bacteroides ovatus ATCC 8483

Annotation: site-specific recombinase, phage integrase family/ribosomal subunit interface protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 293 PF13495: Phage_int_SAM_4" amino acids 2 to 86 (85 residues), 32.7 bits, see alignment E=1.3e-11 PF02899: Phage_int_SAM_1" amino acids 3 to 87 (85 residues), 73 bits, see alignment E=3e-24 TIGR02224: tyrosine recombinase XerC" amino acids 4 to 293 (290 residues), 343 bits, see alignment E=7.8e-107 PF00589: Phage_integrase" amino acids 109 to 280 (172 residues), 142.7 bits, see alignment E=1.5e-45

Best Hits

Swiss-Prot: 38% identical to XERD_STAEQ: Tyrosine recombinase XerD (xerD) from Staphylococcus epidermidis (strain ATCC 35984 / RP62A)

KEGG orthology group: K03733, integrase/recombinase XerC (inferred from 91% identity to bth:BT_2742)

Predicted SEED Role

"Integrase, site-specific recombinase"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (293 amino acids)

>BACOVA_01050 site-specific recombinase, phage integrase family/ribosomal subunit interface protein (Bacteroides ovatus ATCC 8483)
MLIESFLDYLQYERNYSEKTVLAYGEDIKQLQEFAQEEYGKFNPLEVEAELIREWIVSLM
DKGYTSTSVNRKLSSLRTFYKYLLRQGETTIDPLRKIKGPKNKKPLPVFLKENEMNRLLD
ETDFGEGFKGCRDRLIIEVFYATGMRLSELIGLDNKDVDFSASLLKVTGKRNKQRLIPFG
DELQELMLEYINVRNETIPERSEAFFIRENGERLYKNLVYNLVKRNLSKVATLKKKSPHV
LRHTFATTMLNNEAELGVVKELLGHESITTTEIYTHATFEELKKVYKQAHPRA