Protein Info for BACOVA_01013 in Bacteroides ovatus ATCC 8483

Annotation: ribosomal protein S8

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 131 PF00410: Ribosomal_S8" amino acids 3 to 131 (129 residues), 164.6 bits, see alignment E=5.2e-53

Best Hits

Swiss-Prot: 99% identical to RS8_BACTN: 30S ribosomal protein S8 (rpsH) from Bacteroides thetaiotaomicron (strain ATCC 29148 / DSM 2079 / NCTC 10582 / E50 / VPI-5482)

KEGG orthology group: K02994, small subunit ribosomal protein S8 (inferred from 95% identity to bvu:BVU_0791)

MetaCyc: 44% identical to 30S ribosomal subunit protein S8 (Escherichia coli K-12 substr. MG1655)

Predicted SEED Role

"SSU ribosomal protein S8p (S15Ae)" in subsystem Ribosome SSU bacterial

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (131 amino acids)

>BACOVA_01013 ribosomal protein S8 (Bacteroides ovatus ATCC 8483)
MTDPIADYLTRLRNAIGAKHRVVEVPASNLKKEITKILFEKGYILNYKFVEDGPQGTIKV
ALKYDSVNKVNAIKKLERISSPGMRKYTGYKDMPRVINGLGIAIISTSKGVMTNKEAAEL
KIGGEVLCYVY