Protein Info for BACOVA_01010 in Bacteroides ovatus ATCC 8483

Annotation: ribosomal protein S5

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 172 TIGR01021: ribosomal protein uS5" amino acids 15 to 167 (153 residues), 208 bits, see alignment E=3.3e-66 PF00333: Ribosomal_S5" amino acids 16 to 80 (65 residues), 94.8 bits, see alignment E=2.5e-31 PF03719: Ribosomal_S5_C" amino acids 93 to 162 (70 residues), 101.5 bits, see alignment E=1.4e-33

Best Hits

Swiss-Prot: 97% identical to RS5_BACTN: 30S ribosomal protein S5 (rpsE) from Bacteroides thetaiotaomicron (strain ATCC 29148 / DSM 2079 / NCTC 10582 / E50 / VPI-5482)

KEGG orthology group: K02988, small subunit ribosomal protein S5 (inferred from 97% identity to bth:BT_2710)

MetaCyc: 53% identical to 30S ribosomal subunit protein S5 (Escherichia coli K-12 substr. MG1655)

Predicted SEED Role

"SSU ribosomal protein S5p (S2e)" in subsystem Ribosomal protein S5p acylation or Ribosome SSU bacterial

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (172 amino acids)

>BACOVA_01010 ribosomal protein S5 (Bacteroides ovatus ATCC 8483)
MAGVNNRVKITNDIELKDRLVAINRVTKVTKGGRTFSFSAIVVVGNEEGIIGWGLGKAGE
VTAAIAKGVESAKKNLVKVPILKGTVPHEQSARFGGAEVFIKPASHGTGVVAGGAMRAVL
ESVGVTDVLAKSKGSSNPHNLVKATIEALSEMRDARMVAQNRGISVEKVFRG