Protein Info for BACOVA_00993 in Bacteroides ovatus ATCC 8483

Annotation: imidazolonepropionase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 417 TIGR01224: imidazolonepropionase" amino acids 32 to 411 (380 residues), 440.1 bits, see alignment E=3e-136 PF07969: Amidohydro_3" amino acids 127 to 411 (285 residues), 60.9 bits, see alignment E=1.7e-20 PF01979: Amidohydro_1" amino acids 240 to 411 (172 residues), 60.8 bits, see alignment E=1.5e-20

Best Hits

Swiss-Prot: 92% identical to HUTI_BACTN: Imidazolonepropionase (hutI) from Bacteroides thetaiotaomicron (strain ATCC 29148 / DSM 2079 / NCTC 10582 / E50 / VPI-5482)

KEGG orthology group: K01468, imidazolonepropionase [EC: 3.5.2.7] (inferred from 92% identity to bth:BT_2692)

MetaCyc: 47% identical to imidazolone-5-propionate hydrolase (Bacillus subtilis)
Imidazolonepropionase. [EC: 3.5.2.7]

Predicted SEED Role

"Imidazolonepropionase (EC 3.5.2.7)" in subsystem Histidine Degradation (EC 3.5.2.7)

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

No predicted isozymes

Use Curated BLAST to search for 3.5.2.7

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (417 amino acids)

>BACOVA_00993 imidazolonepropionase (Bacteroides ovatus ATCC 8483)
MSENLIIFNARIVTPIGFSARKGEEMSQLQIIENGTVEVTKGIITYVGENRGEDRDGYYQ
HYWHYNARGHCLLPGFVDSHTHFVFGGERSEEFSWRLKGESYMSIMERGGGIASTVKATR
QMNYLKLRSAAESFLKKMSTMGVTTVEGKSGYGLDRDTELLQLKVMRSLNNAEHKRVDIV
STFLGAHALPEEYAGRSDEYIDFLIREMLPLIHSGKWAECCDVFCEQGVFSIEQSRRLLQ
AAKEHGFLLKLHADEIVSLGGAELAAELGALSADHLLHASDAGIRAMADAGVVATLLPLT
AFALKEPYARGREMIDAGCAVALATDLNPGSCFSGSIPLTIALACIYMQMSIEEAITALT
LNGAAALQRADRIGSIEVGKQGDFILLNSDNYHILPYYIGMNCVIMTIKDGILYPVA