Protein Info for BACOVA_00959 in Bacteroides ovatus ATCC 8483

Annotation: dihydrodipicolinate reductase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• PF01113: DapB_N
  • amino acids 1 to 104 (104 residues), 67.3 bits, E=1.4e-22
• TIGR00036: 4-hydroxy-tetrahydrodipicolinate reductase
  • amino acids 42 to 249 (208 residues), 137.3 bits, E=3.5e-44
• PF05173: DapB_C
  • amino acids 107 to 248 (142 residues), 116.7 bits, E=7.7e-38

Best Hits

KEGG orthology group: K00215, dihydrodipicolinate reductase [EC: 1.3.1.26] (inferred from 89% identity to bth:BT_3320)

Predicted SEED Role

"4-hydroxy-tetrahydrodipicolinate reductase (EC 1.17.1.8)" (EC 1.17.1.8)

MetaCyc Pathways

• L-lysine biosynthesis III (7/7 steps found)
• L-lysine biosynthesis VI (7/7 steps found)
• superpathway of L-lysine, L-threonine and L-methionine biosynthesis II (12/15 steps found)
• aspartate superpathway (19/25 steps found)
• L-lysine biosynthesis I (6/9 steps found)
• L-lysine biosynthesis II (6/9 steps found)
• superpathway of L-lysine, L-threonine and L-methionine biosynthesis I (12/18 steps found)

KEGG Metabolic Maps

• Biosynthesis of alkaloids derived from ornithine, lysine and nicotinic acid
• Lysine biosynthesis

Isozymes

No predicted isozymes

Use Curated BLAST to search for 1.17.1.8 or 1.3.1.26

Protein Sequence (254 amino acids)

>BACOVA_00959 dihydrodipicolinate reductase (Bacteroides ovatus ATCC 8483)
MKIALIGYGKMGKEIEKVARSRGHEIVCIIDINNQDDFESEAFKSADVAIEFTNPMVAYS
NYMKAFKAGVKLVSGSTGWMTEHGEEIKKLCTEEGKTLFWSSNFSLGVSIFSALNKYLAK
IMNQFPAYDVTMSETHHIHKLDAPSGTAITLAEGILEKIDRKDKWVKGTFLAPDGTISGT
NDCAPNELPISSIREGEVFGLHTIRYESDVDTISITHDAKSRGGFVLGAVLAAEYTATHE
GFLGMSDLFPFLND