Protein Info for BACOVA_00779 in Bacteroides ovatus ATCC 8483

Annotation: hypothetical protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 242 transmembrane" amino acids 15 to 35 (21 residues), see Phobius details amino acids 47 to 64 (18 residues), see Phobius details amino acids 70 to 92 (23 residues), see Phobius details amino acids 104 to 124 (21 residues), see Phobius details amino acids 132 to 150 (19 residues), see Phobius details amino acids 157 to 176 (20 residues), see Phobius details amino acids 182 to 202 (21 residues), see Phobius details amino acids 214 to 236 (23 residues), see Phobius details PF19540: DUF6064" amino acids 1 to 205 (205 residues), 299.4 bits, see alignment E=8.6e-94

Best Hits

KEGG orthology group: None (inferred from 93% identity to bth:BT_0973)

Predicted SEED Role

"FIG00408327: hypothetical protein"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (242 amino acids)

>BACOVA_00779 hypothetical protein (Bacteroides ovatus ATCC 8483)
MEIFWRTIAYYNSATWLLQIVIILIGIALTGLLIGRPRPWVKMAMKFYMIGLYTWISLVY
YYIYCEERSYNGVMAMFWGVMAIIWIWDAITGYTTFERTHKYDLLSYVLLAMPFIYPLVS
LARGLSFPEMTSPVMPCSVVVFTIGLLLLFAQKVNMFLVLFLCHWSLIGLSKTYFFQIPE
DFLLASATIPGLYLFFREYFLNNLHADTKPKAKYINWLLISVCVGLAVLLTTTMFLELVP
KG