Protein Info for BACOVA_00730 in Bacteroides ovatus ATCC 8483

Annotation: von Willebrand factor type A domain protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 342 transmembrane" amino acids 6 to 26 (21 residues), see Phobius details amino acids 57 to 76 (20 residues), see Phobius details amino acids 307 to 325 (19 residues), see Phobius details PF07584: BatA" amino acids 1 to 76 (76 residues), 27.5 bits, see alignment E=5.3e-10 PF00092: VWA" amino acids 92 to 240 (149 residues), 72.9 bits, see alignment E=6e-24 PF13519: VWA_2" amino acids 92 to 200 (109 residues), 68.4 bits, see alignment E=1.2e-22

Best Hits

KEGG orthology group: K07114, uncharacterized protein (inferred from 94% identity to bth:BT_0906)

Predicted SEED Role

"BatB"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (342 amino acids)

>BACOVA_00730 von Willebrand factor type A domain protein (Bacteroides ovatus ATCC 8483)
MFRFGEPTYLYLLLLLPFLAAFYLYSNYKRRKNIRRFGDPTLLAQLMPDVSKYRPDVKFW
IIFVAIGLFSVLLARPQFGSKLETVKRKGVEVIIALDISNSMLAQDVQPSRLEKAKRLIS
RLVDELDNDKVGMIVFAGDAFTQLPITSDYISAKMFLESISPSLISKQGTAIGEAINLAA
RSFTPQEGVGRAIIVITDGENHEGGAVEAAKAAAEKGIQVSVLGVGMPDGAPIPVEGTND
YRRDREGNVIVTRLNEAMCQEIAKEGKGIYVRVDNSNSAQKAINQEVNKMAKSDVESKVY
TEFNEQFQAIAWVILLLLLAEILILDRKNPLFKNIHLFSNKK