Protein Info for BACOVA_00667 in Bacteroides ovatus ATCC 8483

Annotation: phospholipase D domain protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 398 TIGR04265: cardiolipin synthase" amino acids 15 to 398 (384 residues), 329.4 bits, see alignment E=2.2e-102 PF13091: PLDc_2" amino acids 47 to 157 (111 residues), 42.9 bits, see alignment E=4.4e-15 amino acids 242 to 365 (124 residues), 94.9 bits, see alignment E=3.6e-31 PF00614: PLDc" amino acids 135 to 157 (23 residues), 23.4 bits, see alignment (E = 4.6e-09) amino acids 311 to 338 (28 residues), 33.5 bits, see alignment (E = 3e-12)

Best Hits

KEGG orthology group: K01005, [EC: 2.7.8.-] (inferred from 94% identity to bth:BT_2046)

Predicted SEED Role

"Cardiolipin synthetase (EC 2.7.8.-)" in subsystem Glycerolipid and Glycerophospholipid Metabolism in Bacteria (EC 2.7.8.-)

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

Compare fitness of predicted isozymes for: 2.7.8.-

Use Curated BLAST to search for 2.7.8.-

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (398 amino acids)

>BACOVA_00667 phospholipase D domain protein (Bacteroides ovatus ATCC 8483)
MTQPRDSIGLTSDSLVLHFLEESGIPISDNNKVKLLKSGREKFIDLFEAIREAKHHVHLE
YFNFRNDSIANTLFTLLAEKVKEGVEVRAMFDAFGNWSNNKPLKKRHLKKIREQGIEIVK
FDPFTFPYINHAAHRDHRKIAVIDGKVAYTGGMNIADYYINGLPKIGTWRDMHMRIEGDA
VNDLQEIFLTIWNKETKQNIGGEAYFPQHQEQTDSTNIVVAIVDRTPKKNSRMLSHAYAM
SIYSAQKNVHIVNPYFVPTSSIKKALNRTIDRGVDVTIMVSSASDIPFTPDAALYKLHKL
MKRGATVYMYNGGFHHSKIMMVDDLFCTVGTANLNSRSLRYDYETNAFIFDKKTTGELNN
MFRNDIEHCTQLTPEFWKKRSPWKKFVGWFANLFTPFL