Protein Info for BACOVA_00532 in Bacteroides ovatus ATCC 8483

Annotation: CAAX amino terminal protease family protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 298 transmembrane" amino acids 16 to 37 (22 residues), see Phobius details amino acids 56 to 78 (23 residues), see Phobius details amino acids 99 to 120 (22 residues), see Phobius details amino acids 136 to 157 (22 residues), see Phobius details amino acids 169 to 185 (17 residues), see Phobius details amino acids 191 to 210 (20 residues), see Phobius details amino acids 222 to 238 (17 residues), see Phobius details amino acids 260 to 283 (24 residues), see Phobius details PF02517: Rce1-like" amino acids 135 to 227 (93 residues), 69 bits, see alignment E=1.8e-23

Best Hits

KEGG orthology group: K07052, (no description) (inferred from 78% identity to bth:BT_1239)

Predicted SEED Role

"putative metal-dependent membrane protease"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (298 amino acids)

>BACOVA_00532 CAAX amino terminal protease family protein (Bacteroides ovatus ATCC 8483)
MEADNIDGKKEPKRLPVWACISLFIVVLFIFIGLYGTLVSGGLSLVLGVEARHPGVVGYI
FVEASMLLAVLTAAVILLRLERRPFSDLGLSLKGHASGLWYGLLMAILLYLLGFGISVVL
GEIEVTGFQFKPLDLLGSWVFFLLVALFEEILMRGYILGRLLHTNMNKFLALFISSALFA
FMHIFNPEIAFLPMLNLLLAGMLLGASYLYTRNLCFPISLHLFWNWIQGPILGYQVSGNN
FTTSMLTLRMPEENVLNGGAFGFEGSLICTVLMIVFTILIVWWGEKREAISLAVPRSY