Protein Info for BACOVA_00325 in Bacteroides ovatus ATCC 8483

Annotation: beta-ketoacyl-acyl-carrier-protein synthase III

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• TIGR00747: 3-oxoacyl-[acyl-carrier-protein] synthase III
  • amino acids 5 to 327 (323 residues), 370.8 bits, E=2.7e-115
• PF00108: Thiolase_N
  • amino acids 53 to 153 (101 residues), 29.7 bits, E=6.7e-11
• PF08545: ACP_syn_III
  • amino acids 110 to 188 (79 residues), 102.9 bits, E=1e-33
• PF08541: ACP_syn_III_C
  • amino acids 241 to 327 (87 residues), 109.3 bits, E=1.3e-35

Best Hits

Swiss-Prot: 96% identical to FABH2_BACTN: 3-oxoacyl-[acyl-carrier-protein] synthase 3 protein 2 (fabH2) from Bacteroides thetaiotaomicron (strain ATCC 29148 / DSM 2079 / NCTC 10582 / E50 / VPI-5482)

KEGG orthology group: K00648, 3-oxoacyl-[acyl-carrier-protein] synthase III [EC: 2.3.1.180] (inferred from 96% identity to bth:BT_3834)

Predicted SEED Role

"3-oxoacyl-[acyl-carrier-protein] synthase, KASIII (EC 2.3.1.180)" (EC 2.3.1.180)

MetaCyc Pathways

• superpathway of fatty acids biosynthesis (E. coli) (47/53 steps found)
• superpathway of fatty acid biosynthesis II (plant) (37/43 steps found)
• superpathway of fatty acid biosynthesis I (E. coli) (13/16 steps found)
• fatty acid biosynthesis initiation (type II) (2/3 steps found)
• superpathway of fatty acid biosynthesis initiation (3/5 steps found)
• streptorubin B biosynthesis (20/34 steps found)

KEGG Metabolic Maps

• Fatty acid biosynthesis

Isozymes

Compare fitness of predicted isozymes for: 2.3.1.180

Use Curated BLAST to search for 2.3.1.180

Protein Sequence (335 amino acids)

>BACOVA_00325 beta-ketoacyl-acyl-carrier-protein synthase III (Bacteroides ovatus ATCC 8483)
MEKINAVITGVGGYVPDYILTNDEISKMVDTNDEWIMTRIGVKERHILNEEGLGSSYMAR
KAAKQLMKKTGANPDDIDLVVVATTTPDYHFPSTASILCDKLGLKNAFAFDLQAACSGFL
YLMETAANFIRSGRYKKIIIVGADKMSSMVNYTDRATCPIFGDGAAAFMVEPTTEDYGIM
DSILRTDGKGLPFLHMKAGGSVCPPSYFTVDNKMHYLFQEGRTVFKYAVSNMSDVSAAIA
EKNGLTKDSINWIVPHQANVRIIEAVAHRMDVPMDKVLVNIEHYGNTSAATLPLCIWDYE
DKLKKGDNIIFTAFGAGFTWGAVYVKWGYDGKKES