Protein Info for BACOVA_00141 in Bacteroides ovatus ATCC 8483

Annotation: oxidoreductase, short chain dehydrogenase/reductase family protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• PF00106: adh_short
  • amino acids 12 to 204 (193 residues), 203.9 bits, E=2.6e-64
• PF08659: KR
  • amino acids 14 to 165 (152 residues), 48.4 bits, E=1.6e-16
• PF13561: adh_short_C2
  • amino acids 18 to 258 (241 residues), 214.5 bits, E=2.6e-67

Best Hits

Swiss-Prot: 47% identical to IDNO_ECOL6: 5-keto-D-gluconate 5-reductase (idnO) from Escherichia coli O6:H1 (strain CFT073 / ATCC 700928 / UPEC)

KEGG orthology group: K00046, gluconate 5-dehydrogenase [EC: 1.1.1.69] (inferred from 96% identity to bth:BT_3232)

MetaCyc: 78% identical to 2-dehydro-3-deoxy-D-gluconate 5-dehydrogenase monomer (Streptococcus agalactiae NEM316)
2-dehydro-3-deoxy-D-gluconate 5-dehydrogenase. [EC: 1.1.1.127]

Predicted SEED Role

"5-keto-D-gluconate 5-reductase (EC 1.1.1.69)" in subsystem D-gluconate and ketogluconates metabolism (EC 1.1.1.69)

MetaCyc Pathways

• 4-deoxy-L-threo-hex-4-enopyranuronate degradation (5/5 steps found)
• 3,6-anhydro-α-L-galactopyranose degradation (4/7 steps found)
• L-idonate degradation (1/3 steps found)
• ketogluconate metabolism (1/8 steps found)
• superpathway of microbial D-galacturonate and D-glucuronate degradation (16/31 steps found)

KEGG Metabolic Maps

• Pentose and glucuronate interconversions

Isozymes

No predicted isozymes

Use Curated BLAST to search for 1.1.1.127 or 1.1.1.69

Protein Sequence (267 amino acids)

>BACOVA_00141 oxidoreductase, short chain dehydrogenase/reductase family protein (Bacteroides ovatus ATCC 8483)
MNQFLNFSLEGKVALVTGASYGIGFAIASAFAEQGAKVCFNDINQELVDKGMAAYAAKGI
KAHGYVCDVTDEPAVQAMVATIAKEVGTIDILVNNAGIIRRVPMHEMDAADFRRVIDIDL
NAPFIVAKAVLPAMMEKRAGKIINICSMMSELGRETVSAYAAAKGGLKMLTRNICSEYGE
YNIQCNGIGPGYIATPQTAPLREPQADGSRHPFDSFICAKTPAGRWLDPEELTGPAVFLA
SEASNAVNGHILYVDGGILAYIGKQPK