Protein Info for BACOVA_00083 in Bacteroides ovatus ATCC 8483

Annotation: ABC transporter, permease protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 240 signal peptide" amino acids 1 to 15 (15 residues), see Phobius details transmembrane" amino acids 38 to 63 (26 residues), see Phobius details amino acids 75 to 97 (23 residues), see Phobius details amino acids 108 to 126 (19 residues), see Phobius details amino acids 162 to 184 (23 residues), see Phobius details amino acids 204 to 225 (22 residues), see Phobius details PF00528: BPD_transp_1" amino acids 54 to 224 (171 residues), 65.1 bits, see alignment E=3.6e-22

Best Hits

KEGG orthology group: K11071, spermidine/putrescine transport system permease protein (inferred from 97% identity to bth:BT_1290)

Predicted SEED Role

"Spermidine Putrescine ABC transporter permease component PotB (TC 3.A.1.11.1)" in subsystem Polyamine Metabolism (TC 3.A.1.11.1)

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (240 amino acids)

>BACOVA_00083 ABC transporter, permease protein (Bacteroides ovatus ATCC 8483)
MIIPLFLIVVYAFTDDSGHLTLANFQKFFEHPEAINTFVYSIGIAIITTLVCILLGYPAA
WILSNSKLNRSKTMVVLFILPMWVNILVRTLATVALFDFFSVPLGEGALIFGMVYNFIPF
MIYPIYNTLQKMDHSYIEAAQDLGANPVQVFLKAVLPLSMPGVMSGIMMVFMPTISTFAI
AELLTMNNIKLFGTTIQENINNSMWNYGAALSLIMLLLIAATSLFSTDDKENSNEGGGLW