Protein Info for B158DRAFT_2530 in Kangiella aquimarina DSM 16071

Annotation: nitrogen regulatory protein P-II family

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• PF00543: P-II
  • amino acids 1 to 108 (108 residues), 166.6 bits, E=1e-53

Best Hits

Swiss-Prot: 79% identical to GLNB_HAEIN: Nitrogen regulatory protein P-II (glnB) from Haemophilus influenzae (strain ATCC 51907 / DSM 11121 / KW20 / Rd)

KEGG orthology group: K04751, nitrogen regulatory protein P-II 1 (inferred from 96% identity to kko:Kkor_1080)

MetaCyc: 77% identical to nitrogen regulatory protein PII-1 (Escherichia coli K-12 substr. MG1655)

Predicted SEED Role

"Nitrogen regulatory protein P-II" in subsystem Ammonia assimilation

Protein Sequence (112 amino acids)

>B158DRAFT_2530 nitrogen regulatory protein P-II family (Kangiella aquimarina DSM 16071)
MKKIEAIIKPFKLDDIREALTDLGVNGMTVTEVKGFGRQKGHTELYRGAEYMVDFLPKAK
IEVVIDDDLVDKCVETIIEVARTGKIGDGKIFVTNIERAVRIRTGEEGEDAI