Protein Info for B158DRAFT_2495 in Kangiella aquimarina DSM 16071

Annotation: putative efflux protein, MATE family

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 467 transmembrane" amino acids 26 to 47 (22 residues), see Phobius details amino acids 59 to 84 (26 residues), see Phobius details amino acids 104 to 123 (20 residues), see Phobius details amino acids 144 to 162 (19 residues), see Phobius details amino acids 174 to 195 (22 residues), see Phobius details amino acids 205 to 228 (24 residues), see Phobius details amino acids 254 to 279 (26 residues), see Phobius details amino acids 291 to 316 (26 residues), see Phobius details amino acids 328 to 351 (24 residues), see Phobius details amino acids 363 to 382 (20 residues), see Phobius details amino acids 403 to 421 (19 residues), see Phobius details amino acids 431 to 451 (21 residues), see Phobius details TIGR00797: MATE efflux family protein" amino acids 33 to 433 (401 residues), 263.7 bits, see alignment E=1.3e-82 PF01554: MatE" amino acids 33 to 191 (159 residues), 106.3 bits, see alignment E=6.8e-35 amino acids 259 to 418 (160 residues), 90.1 bits, see alignment E=6.7e-30

Best Hits

Swiss-Prot: 33% identical to MDTK_KLEP3: Multidrug resistance protein MdtK (mdtK) from Klebsiella pneumoniae (strain 342)

KEGG orthology group: K03327, multidrug resistance protein, MATE family (inferred from 92% identity to kko:Kkor_1044)

Predicted SEED Role

"Multi antimicrobial extrusion protein (Na(+)/drug antiporter), MATE family of MDR efflux pumps" in subsystem Multidrug Resistance Efflux Pumps

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (467 amino acids)

>B158DRAFT_2495 putative efflux protein, MATE family (Kangiella aquimarina DSM 16071)
MADSADNKTSNHSSHSWQDIRHETSAIIRIAIPAILAQLAQMSLGVIDTLMAGNYSSNAL
AAVGTGFNAFMIIFSLFMGLMMAINPMVAHFNGQGKMESIGKTFQMGMFLAIIFGIITFI
LLRNVDPFLTLLGVEEAIVETTGGYLKALSWGCVFAFLFIALRSGNEGLFSTKIIMICSF
MVIPFNLLFNTWFIYGGFGVPAMGAIGVGYATSVVWTLLFLFLLFFTWRNPSFASLNIFK
KVRLPTWQLIKEFFSIGTPMSLGLLMEVSMFGMIGILVARYGVDLTGAHQIAMNIATVAF
MVPWGLSIAITARVGYWMGRQDYRQMRLSGFCGIGASLFFQAVSVTIMLFFRYELVGVYT
DNQAIIEISASLIFLAAIFQFSDGLQVNSAGALRGMKDTKIPTVYMAIAYWLIGFPIGIY
LADHMDLKVQGFWIGIIFGLTVAAILLLGRFIHRSKQTIAFAESGEG