Protein Info for B158DRAFT_2491 in Kangiella aquimarina DSM 16071

Annotation: ferrochelatase (EC 4.99.1.1)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

Best Hits

Swiss-Prot: 53% identical to HEMH_AERHH: Ferrochelatase (hemH) from Aeromonas hydrophila subsp. hydrophila (strain ATCC 7966 / DSM 30187 / JCM 1027 / KCTC 2358 / NCIMB 9240)

KEGG orthology group: K01772, ferrochelatase [EC: 4.99.1.1] (inferred from 95% identity to kko:Kkor_1040)

Predicted SEED Role

"Ferrochelatase, protoheme ferro-lyase (EC 4.99.1.1)" in subsystem Experimental tye or Heme and Siroheme Biosynthesis (EC 4.99.1.1)

MetaCyc Pathways

superpathway of heme b biosynthesis from glutamate (9/10 steps found)
superpathway of heme b biosynthesis from glycine (6/8 steps found)
heme b biosynthesis I (aerobic) (3/4 steps found)
heme b biosynthesis II (oxygen-independent) (3/4 steps found)
heme b biosynthesis V (aerobic) (3/4 steps found)
superpathway of heme b biosynthesis from uroporphyrinogen-III (4/6 steps found)

KEGG Metabolic Maps

Porphyrin and chlorophyll metabolism

Isozymes

No predicted isozymes

Use Curated BLAST to search for 4.99.1.1

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (330 amino acids)

>B158DRAFT_2491 ferrochelatase (EC 4.99.1.1) (Kangiella aquimarina DSM 16071)
MKKQGVLLCNLGTPDEPTPKAVRRYLAEFLHDYRVVSLTRWVWCLILHGIILRIRPAKVA
KLYKSIWTREGSPLLAITQRQRKKLQIMMNDRFVEQEYGKHIPVEIAMAYGNPSIPKALK
ALKNQGCERIIVLPLYPQYSSASTASIFDRVAKAMKQEFFVPEFTFVGDYHDNPLYIKAL
ADSIQRHWNEHGKADKLLFSYHGVPERFSKGGDPYEQQCHKTTELVIKELGLEEGDYLTS
FQSRFGKEEWIKPYTDATLETWGKEGVESVQVICPAFSADCLETLEEIAEENKDVFIEHG
GKRYEYIPALNDDDAHVEMMLTLIEQRLLK