Protein Info for B158DRAFT_2481 in Kangiella aquimarina DSM 16071

Annotation: Predicted O-methyltransferase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• PF01596: Methyltransf_3
  • amino acids 17 to 210 (194 residues), 213.3 bits, E=4.7e-67
• PF13847: Methyltransf_31
  • amino acids 57 to 177 (121 residues), 35.9 bits, E=1.3e-12
• PF13649: Methyltransf_25
  • amino acids 61 to 134 (74 residues), 31.1 bits, E=6.4e-11
• PF13578: Methyltransf_24
  • amino acids 62 to 163 (102 residues), 57.5 bits, E=4.7e-19

Best Hits

Swiss-Prot: 34% identical to CAMT2_DICDI: Probable caffeoyl-CoA O-methyltransferase 2 (omt6) from Dictyostelium discoideum

KEGG orthology group: K00588, caffeoyl-CoA O-methyltransferase [EC: 2.1.1.104] (inferred from 87% identity to kko:Kkor_1027)

Predicted SEED Role

"O-methyltransferase family protein"

MetaCyc Pathways

• scopoletin biosynthesis (2/3 steps found)
• capsaicin biosynthesis (2/7 steps found)
• chlorogenic acid biosynthesis I (1/8 steps found)
• avenanthramide biosynthesis (1/9 steps found)
• curcuminoid biosynthesis (1/10 steps found)
• phenylpropanoids methylation (ice plant) (1/10 steps found)
• coumarins biosynthesis (engineered) (3/13 steps found)
• monolignol biosynthesis (1/15 steps found)
• suberin monomers biosynthesis (3/20 steps found)

KEGG Metabolic Maps

• Biosynthesis of phenylpropanoids
• Flavonoid biosynthesis
• Phenylpropanoid biosynthesis

Isozymes

No predicted isozymes

Use Curated BLAST to search for 2.1.1.104

Protein Sequence (210 amino acids)

>B158DRAFT_2481 Predicted O-methyltransferase (Kangiella aquimarina DSM 16071)
MNFIDKEIEEYAKLYTSNEPELLKELAEFTETNMPMAQMLTGKIEGRLLKMLVALTGAKS
ILEIGMFTGYSALSLAEALPEDGRLLTCDIDEEVAKLAQEYFARSLHGSKITVQLGPALE
TLSKTNQTFDLVFLDADKENYVEYYQSIIPKLNSNGLLVIDNCLWSGKVLEPQAETDVAI
HKLNQLIVTDPRVENVVLTVRDGVNLVRKL